dbPTM

Y1049_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	Y1049_ARATH
UniProt AC	Q9MAU5
Protein Name	Putative BPI/LBP family protein At1g04970
Gene Name	At1g04970
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	488
Subcellular Localization
Protein Description
Protein Sequence	MDVGRCFLFLLLPSFFFLPSQTQSTDSFTSVLVSQNGLDFVKNLLVNKAIASIIPLQIPRIEKSMKIPFLGGIDVVVSNLTIYELDVASSYVKLGETGVVIVASGTTCNLSMNWHYSYSTWLPPIEISDQGIASVQVQGMEIGLSLGLKSDEGGLKLSLSECGCHVEDITIELEGGASWFYQGMVNAFKDQIGSSVESTIAKKLTEGVSDLDSFLQSLPKEIPVDDNADLNVTFTSDPILRNSSITFEIDGLFTKGETNQVLKSFFKKSVSLVICPGNSKMLGISVDEAVFNSAAALYYNADFVQWVVDKIPEQSLLNTARWRFIIPQLYKKYPNQDMNLNISLSSPPLVKISEQYVGANVNADLVINVLDANQVIPVACISLMIRGSGALRVMGNNLGGSVSLEDFSMSLKWSNIGNLHLHLLQPIVWTVIQTVFVPYANDHLEKGFPLPIMHGFTLQNAEIICSESEITVCSDVAYLDSSQQPQWL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
79	N-linked_Glycosylation	GIDVVVSNLTIYELD CEEEEEECCEEEEHH	29.59	-
109	N-linked_Glycosylation	VASGTTCNLSMNWHY EECCCEEEEEEEEEE	32.81	-
145	Phosphorylation	QGMEIGLSLGLKSDE CCEEEEEEEECCCCC	18.38	28011693
231	N-linked_Glycosylation	VDDNADLNVTFTSDP CCCCCCCEEEEECCC	31.19	-
242	N-linked_Glycosylation	TSDPILRNSSITFEI ECCCCCCCCCEEEEE	36.34	-
341	N-linked_Glycosylation	PNQDMNLNISLSSPP CCCCCCEEEEECCCC	19.46	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of Y1049_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of Y1049_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of Y1049_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of Y1049_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of Y1049_ARATH

Related Literatures of Post-Translational Modification