dbPTM

XTH7_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	XTH7_ARATH
UniProt AC	Q8LER3
Protein Name	Probable xyloglucan endotransglucosylase/hydrolase protein 7
Gene Name	XTH7
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	293
Subcellular Localization	Secreted, cell wall . Secreted, extracellular space, apoplast .
Protein Description	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity)..
Protein Sequence	MVVSLFSSRNVFYTLSLCLFAALYQPVMSRPAKFEDDFRIAWSDTHITQIDGGRAIQLKLDPSSGCGFASKKQYLFGRVSMKIKLIPGDSAGTVTAFYMNSDTDSVRDELDFEFLGNRSGQPYTVQTNVFAHGKGDREQRVNLWFDPSRDFHEYAISWNHLRIVFYVDNVPIRVYKNNEARKVPYPRFQPMGVYSTLWEADDWATRGGIEKINWSRAPFYAYYKDFDIEGCPVPGPADCPANSKNWWEGSAYHQLSPVEARSYRWVRVNHMVYDYCTDKSRFPVPPPECSAGI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
117	N-linked_Glycosylation	LDFEFLGNRSGQPYT CCEEEECCCCCCCEE	36.77	-
213	N-linked_Glycosylation	RGGIEKINWSRAPFY HCCCEECCCCCCCEE	41.56	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of XTH7_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of XTH7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of XTH7_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of XTH7_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of XTH7_ARATH

Related Literatures of Post-Translational Modification