dbPTM

XRI1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	XRI1_ARATH
UniProt AC	Q6NLW5
Protein Name	Protein XRI1
Gene Name	XRI1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	300
Subcellular Localization	Nucleus .
Protein Description	Required for mitotic division of the generative cell nucleus and the development of mature tricellular pollen grains, and for male and female meiosis..
Protein Sequence	MDYGDDDRSSSWNWQVDNYNHQPQSHFSDVPDCTMTEVTLNQEDHSYMFDDENTPVKACSELGYHVTTEDTNRKMEVHSETRSALKRRRMLQFEDQPETSLFSSESFSAILKSSARDDTFDELLPEGSQLIEGFSEDASASSFEGLDLYAEEWYADCLNDAETPMLPDDLNFGSPDVQVDISEYLNVPPETETREVQRPVTRSSPNVIFKGRKSFSRPVSKLPSSIIYPFAFIKPCGVHGGMTLKDINQKIRNPPAKPKAHIEEPAVIQTSAFSGKPVVGKTKIRTEGGKGSITIMRTRG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of XRI1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of XRI1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of XRI1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of XRI1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
MIP1_ARATH	AT1G32530	physical	19187040

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of XRI1_ARATH

Related Literatures of Post-Translational Modification