dbPTM

XRCC4_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	XRCC4_ARATH
UniProt AC	Q682V0
Protein Name	DNA repair protein XRCC4
Gene Name	XRCC4
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	264
Subcellular Localization	Nucleus .
Protein Description	May be involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair. May bind to DNA. The LIG4-XRCC4 complex is probably responsible for the NHEJ ligation step, and XRCC4 may enhance the joining activity of LIG4 (By similarity)..
Protein Sequence	MIGVDSKSSSTTFIETMVESEKTKHTCLRLEISGADPIFVKGTWHNSRFDISVTDGSSSWICNATEEEVAERAAQWDQPVSEYLKLAEQYLGFQQPNSVYSFSDALEGSKRLSWTFEKEGTKLEWRWKCKPSDDSKKITVGILDFLMEANIRLSEEVVNKTRSFEKMRSEAERCLAQGEKLCDEKTEFESATYAKFLSVLNAKKAKLRALRDKEDSVRVVEEEESTDKAESFESGRSDDEKSEEEASKKATSSKARGGKRAARS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
225	Phosphorylation	RVVEEEESTDKAESF EEEECCCCCCHHHHH	45.23	19880383
226	Phosphorylation	VVEEEESTDKAESFE EEECCCCCCHHHHHH	44.81	19880383
231	Phosphorylation	ESTDKAESFESGRSD CCCCHHHHHHCCCCC	38.89	19880383
234	Phosphorylation	DKAESFESGRSDDEK CHHHHHHCCCCCCHH	37.18	30407730
237	Phosphorylation	ESFESGRSDDEKSEE HHHHCCCCCCHHCHH	53.60	19880383
242	Phosphorylation	GRSDDEKSEEEASKK CCCCCHHCHHHHHHH	48.47	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of XRCC4_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of XRCC4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of XRCC4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of XRCC4_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of XRCC4_ARATH

Related Literatures of Post-Translational Modification