dbPTM

XRCC3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	XRCC3_ARATH
UniProt AC	Q9FKM5
Protein Name	DNA repair protein XRCC3 homolog
Gene Name	XRCC3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	304
Subcellular Localization	Nucleus .
Protein Description	Plays essential roles in DNA damage repair in both somatic and meiotic cells. It is important for postsynaptic events following pachytene in meiosis. It is also required for DNA cross-links repair and is involved in double strand breaks (DSBs) repair..
Protein Sequence	MQNGKIKPENLLRRSPTNRKLTTGCEILDGCLRGGISCDSLTEIVAESGCGKTQLCLQLSLCTQLPISHGGLNGSSLYLHSEFPFPFRRLHQLSHTFHQSNPSIYANYNDNPCDHVFVQNVHSVDHLFDIMPRIDGFVGNSKTRFPLKLIVLDSVAALFRSEFDNTPSDLKKRSSLFFKISGKLKQLASKFDLAIVITNQVTDLVETSDGLSGLRIGNLRYLYSSGRRVVPSLGLAWANCVNSRFFISRSDGSIVKDRSEKDENCSSSVSRSAKRRLDIVFSPYLPGSSCEFMITREGICAVQA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
259	Phosphorylation	GSIVKDRSEKDENCS CCCCCCCCCCCCCCC	60.16	23776212
266	Phosphorylation	SEKDENCSSSVSRSA CCCCCCCCHHHHHHH	36.91	23776212
267	Phosphorylation	EKDENCSSSVSRSAK CCCCCCCHHHHHHHH	36.64	23776212
268	Phosphorylation	KDENCSSSVSRSAKR CCCCCCHHHHHHHHH	14.07	23776212
270	Phosphorylation	ENCSSSVSRSAKRRL CCCCHHHHHHHHHHC	23.59	23776212
272	Phosphorylation	CSSSVSRSAKRRLDI CCHHHHHHHHHHCEE	30.54	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of XRCC3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of XRCC3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of XRCC3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of XRCC3_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of XRCC3_ARATH

Related Literatures of Post-Translational Modification