UniProt ID | XPA_MOUSE | |
---|---|---|
UniProt AC | Q64267 | |
Protein Name | DNA repair protein complementing XP-A cells homolog | |
Gene Name | Xpa | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 272 | |
Subcellular Localization | Nucleus. | |
Protein Description | Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. Required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation (By similarity).. | |
Protein Sequence | MATAEEKQTSPEPVAADEPAQLPAAVRASVERKRQRALMLRQARLAARPYPAAAATGGVASVKAAPKMIDTKGGFILEEEEEKHEIGNIVHEPGPVMEFDYTICEECGKEFMDSYLMNHFDLPTCDSCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALRFLVKKNPRHSQWGDMKLYLKLQVVKRALEVWGSQEALEDAKEVRQENREKMKQKKFDKKVKELRRAIRSSVWKRETTTHQHKYGPEENLEDDMYRKTCTLCGHELTYEKM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATAEEKQT ------CCCHHHCCC | 18.60 | - | |
9 | Phosphorylation | ATAEEKQTSPEPVAA CCHHHCCCCCCCCCC | 58.27 | 25521595 | |
10 | Phosphorylation | TAEEKQTSPEPVAAD CHHHCCCCCCCCCCC | 25.44 | 22942356 | |
195 | Phosphorylation | RALEVWGSQEALEDA HHHHHHCCHHHHHHH | 14.77 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of XPA_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of XPA_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of XPA_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...