XLF1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: XLF1_SCHPO
• UniProt AC: Q9P7J2
• Protein Name: Xrcc4-like factor 1
• Gene Name: xlf1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 203
• Subcellular Localization: Nucleus .
• Protein Description: Involved in non-homologous end joining (NHEJ) in the repair of double-strand DNA breaks (DSB). Has a role in meiosis..
• Protein Sequence: MSWVQLRGHRFHFIQASFDAESNEAVQVIHITDLVRVWSCTCSRNQIVNQAESERCPIDPFQTFETLVDVLAEVLVNVSSESRIQLRGSNDEGSLKIFCTSKIAKDIFLEWNWTLWLTPPETIAKMVWFPLINHHLFESETDTSPGSLMSIIRDQKSLLNDKTWFKEALNERSSSSNPSTPRKRSAFADIISPKRPRTRYDFV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
173	Phosphorylation	KEALNERSSSSNPST HHHHHHHCCCCCCCC	28.52	21712547
174	Phosphorylation	EALNERSSSSNPSTP HHHHHHCCCCCCCCH	43.96	24763107
176	Phosphorylation	LNERSSSSNPSTPRK HHHHCCCCCCCCHHH	55.50	21712547
179	Phosphorylation	RSSSSNPSTPRKRSA HCCCCCCCCHHHHHH	56.12	21712547
180	Phosphorylation	SSSSNPSTPRKRSAF CCCCCCCCHHHHHHH	28.50	24763107
192	Phosphorylation	SAFADIISPKRPRTR HHHCHHCCCCCCCCC	25.38	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of XLF1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of XLF1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of XLF1_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of XLF1_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.