UniProt ID | XLF1_SCHPO | |
---|---|---|
UniProt AC | Q9P7J2 | |
Protein Name | Xrcc4-like factor 1 | |
Gene Name | xlf1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 203 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in non-homologous end joining (NHEJ) in the repair of double-strand DNA breaks (DSB). Has a role in meiosis.. | |
Protein Sequence | MSWVQLRGHRFHFIQASFDAESNEAVQVIHITDLVRVWSCTCSRNQIVNQAESERCPIDPFQTFETLVDVLAEVLVNVSSESRIQLRGSNDEGSLKIFCTSKIAKDIFLEWNWTLWLTPPETIAKMVWFPLINHHLFESETDTSPGSLMSIIRDQKSLLNDKTWFKEALNERSSSSNPSTPRKRSAFADIISPKRPRTRYDFV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
173 | Phosphorylation | KEALNERSSSSNPST HHHHHHHCCCCCCCC | 28.52 | 21712547 | |
174 | Phosphorylation | EALNERSSSSNPSTP HHHHHHCCCCCCCCH | 43.96 | 24763107 | |
176 | Phosphorylation | LNERSSSSNPSTPRK HHHHCCCCCCCCHHH | 55.50 | 21712547 | |
179 | Phosphorylation | RSSSSNPSTPRKRSA HCCCCCCCCHHHHHH | 56.12 | 21712547 | |
180 | Phosphorylation | SSSSNPSTPRKRSAF CCCCCCCCHHHHHHH | 28.50 | 24763107 | |
192 | Phosphorylation | SAFADIISPKRPRTR HHHCHHCCCCCCCCC | 25.38 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of XLF1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of XLF1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of XLF1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of XLF1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...