XERO2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: XERO2_ARATH
• UniProt AC: P42758
• Protein Name: Dehydrin Xero 2
• Gene Name: XERO2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 193
• Protein Sequence: MNSHQNQTGVQKKGITEKIMEKLPGHHGPTNTGVVHHEKKGMTEKVMEQLPGHHGATGTGGVHHEKKGMTEKVMEQLPGHHGSHQTGTNTTYGTTNTGGVHHEKKSVTEKVMEKLPGHHGSHQTGTNTAYGTNTNVVHHEKKGIAEKIKEQLPGHHGTHKTGTTTSYGNTGVVHHENKSTMDKIKEKLPGGHH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
161	Phosphorylation	GHHGTHKTGTTTSYG CCCCCCCCCCCCCCC	31.96	27288362
163	Phosphorylation	HGTHKTGTTTSYGNT CCCCCCCCCCCCCCC	31.94	27288362
164	Phosphorylation	GTHKTGTTTSYGNTG CCCCCCCCCCCCCCC	18.32	27288362
165	Phosphorylation	THKTGTTTSYGNTGV CCCCCCCCCCCCCCE	21.57	27288362
166	Phosphorylation	HKTGTTTSYGNTGVV CCCCCCCCCCCCCEE	29.02	27288362
167	Phosphorylation	KTGTTTSYGNTGVVH CCCCCCCCCCCCEEE	16.59	27288362
170	Phosphorylation	TTTSYGNTGVVHHEN CCCCCCCCCEEECCC	27.30	27288362

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of XERO2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of XERO2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of XERO2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of XERO2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.