UniProt ID | XERO2_ARATH | |
---|---|---|
UniProt AC | P42758 | |
Protein Name | Dehydrin Xero 2 | |
Gene Name | XERO2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 193 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MNSHQNQTGVQKKGITEKIMEKLPGHHGPTNTGVVHHEKKGMTEKVMEQLPGHHGATGTGGVHHEKKGMTEKVMEQLPGHHGSHQTGTNTTYGTTNTGGVHHEKKSVTEKVMEKLPGHHGSHQTGTNTAYGTNTNVVHHEKKGIAEKIKEQLPGHHGTHKTGTTTSYGNTGVVHHENKSTMDKIKEKLPGGHH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
161 | Phosphorylation | GHHGTHKTGTTTSYG CCCCCCCCCCCCCCC | 31.96 | 27288362 | |
163 | Phosphorylation | HGTHKTGTTTSYGNT CCCCCCCCCCCCCCC | 31.94 | 27288362 | |
164 | Phosphorylation | GTHKTGTTTSYGNTG CCCCCCCCCCCCCCC | 18.32 | 27288362 | |
165 | Phosphorylation | THKTGTTTSYGNTGV CCCCCCCCCCCCCCE | 21.57 | 27288362 | |
166 | Phosphorylation | HKTGTTTSYGNTGVV CCCCCCCCCCCCCEE | 29.02 | 27288362 | |
167 | Phosphorylation | KTGTTTSYGNTGVVH CCCCCCCCCCCCEEE | 16.59 | 27288362 | |
170 | Phosphorylation | TTTSYGNTGVVHHEN CCCCCCCCCEEECCC | 27.30 | 27288362 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of XERO2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of XERO2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of XERO2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of XERO2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...