XDJ1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: XDJ1_SCHPO
• UniProt AC: O94657
• Protein Name: DnaJ protein homolog xdj1
• Gene Name: xdj1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 413
• Subcellular Localization: Endoplasmic reticulum membrane ; Lipid-anchor .
• Protein Sequence: MVVDTKLYDILEVHFEASAEEIKKSYKRLALLHHPDKAPIHEKEEAAERFRGVQEAYDILKDPESREMYDMYGMNSDSNSQFDGGVNLDDVLAQMFGMNFEAGGPGKNVPRDRKRRGSDVIHDYEISLEDMFKGKEVKLRATRNTLCPRCQGRGGKRFAKEKPCLSCDGKGVKQHLKHVGPHHVTNSQVICDTCNGKGVSFRGKDRCKHCKGSGTVPEQRMLSFFVNRSAKENDKIIQRGMADEAYGITPGDVILQLHQKPHPVFERLGDDLKAKLKISLAEALTGFNRVILTTLDGRGLEYVQPIGKILHPGDCLIIPGEGMYKDSKTDLRGDLYLEVDIEFPKDGLIGTTEIEILRDILPSIPKVSVMDDTLIDSVRGVPGDISHFGGDARYANEDYGDETYEGVPECQAQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
118	Phosphorylation	RDRKRRGSDVIHDYE CCHHCCCCCCCCEEE	27.22	25720772
124	Phosphorylation	GSDVIHDYEISLEDM CCCCCCEEECCHHHH	10.86	29996109
127	Phosphorylation	VIHDYEISLEDMFKG CCCEEECCHHHHHCC	17.48	29996109
410	Methylation	TYEGVPECQAQ---- CCCCCCHHCCC----	3.13	-
410	Farnesylation	TYEGVPECQAQ---- CCCCCCHHCCC----	3.13	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of XDJ1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of XDJ1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of XDJ1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YOFG_SCHPO	SPBP4H10.16c	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.