UniProt ID | XDJ1_SCHPO | |
---|---|---|
UniProt AC | O94657 | |
Protein Name | DnaJ protein homolog xdj1 | |
Gene Name | xdj1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 413 | |
Subcellular Localization |
Endoplasmic reticulum membrane Lipid-anchor . |
|
Protein Description | ||
Protein Sequence | MVVDTKLYDILEVHFEASAEEIKKSYKRLALLHHPDKAPIHEKEEAAERFRGVQEAYDILKDPESREMYDMYGMNSDSNSQFDGGVNLDDVLAQMFGMNFEAGGPGKNVPRDRKRRGSDVIHDYEISLEDMFKGKEVKLRATRNTLCPRCQGRGGKRFAKEKPCLSCDGKGVKQHLKHVGPHHVTNSQVICDTCNGKGVSFRGKDRCKHCKGSGTVPEQRMLSFFVNRSAKENDKIIQRGMADEAYGITPGDVILQLHQKPHPVFERLGDDLKAKLKISLAEALTGFNRVILTTLDGRGLEYVQPIGKILHPGDCLIIPGEGMYKDSKTDLRGDLYLEVDIEFPKDGLIGTTEIEILRDILPSIPKVSVMDDTLIDSVRGVPGDISHFGGDARYANEDYGDETYEGVPECQAQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
118 | Phosphorylation | RDRKRRGSDVIHDYE CCHHCCCCCCCCEEE | 27.22 | 25720772 | |
124 | Phosphorylation | GSDVIHDYEISLEDM CCCCCCEEECCHHHH | 10.86 | 29996109 | |
127 | Phosphorylation | VIHDYEISLEDMFKG CCCEEECCHHHHHCC | 17.48 | 29996109 | |
410 | Methylation | TYEGVPECQAQ---- CCCCCCHHCCC---- | 3.13 | - | |
410 | Farnesylation | TYEGVPECQAQ---- CCCCCCHHCCC---- | 3.13 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of XDJ1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of XDJ1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of XDJ1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YOFG_SCHPO | SPBP4H10.16c | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...