WRK30_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: WRK30_ARATH
• UniProt AC: Q9FL62
• Protein Name: Probable WRKY transcription factor 30
• Gene Name: WRKY30
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 303
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity)..
• Protein Sequence: MEKNHSSGEWEKMKNEINELMIEGRDYAHQFGSASSQETREHLAKKILQSYHKSLTIMNYSGELDQVSQGGGSPKSDDSDQEPLVIKSSKKSMPRWSSKVRIAPGAGVDRTLDDGFSWRKYGQKDILGAKFPRGYYRCTYRKSQGCEATKQVQRSDENQMLLEISYRGIHSCSQAANVGTTMPIQNLEPNQTQEHGNLDMVKESVDNYNHQAHLHHNLHYPLSSTPNLENNNAYMLQMRDQNIEYFGSTSFSSDLGTSINYNFPASGSASHSASNSPSTVPLESPFESYDPNHPYGGFGGFYS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
76	Phosphorylation	QGGGSPKSDDSDQEP CCCCCCCCCCCCCCC	50.46	23572148

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of WRK30_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of WRK30_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of WRK30_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
WRK53_ARATH	WRKY53	physical	22268143
WRK54_ARATH	WRKY54	physical	22268143
WRK70_ARATH	WRKY70	physical	22268143

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.