WRK11_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: WRK11_ARATH
• UniProt AC: Q9SV15
• Protein Name: Probable WRKY transcription factor 11
• Gene Name: WRKY11
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 325
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity)..
• Protein Sequence: MAVDLMRFPKIDDQTAIQEAASQGLQSMEHLIRVLSNRPEQQHNVDCSEITDFTVSKFKTVISLLNRTGHARFRRGPVHSTSSAASQKLQSQIVKNTQPEAPIVRTTTNHPQIVPPPSSVTLDFSKPSIFGTKAKSAELEFSKENFSVSLNSSFMSSAITGDGSVSNGKIFLASAPLQPVNSSGKPPLAGHPYRKRCLEHEHSESFSGKVSGSAYGKCHCKKSRKNRMKRTVRVPAISAKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDPAMLIVTYEGEHRHNQSAMQENISSSGINDLVFASA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
106	Phosphorylation	PEAPIVRTTTNHPQI CCCCEEEEECCCCCC	27.38	24894044
107	Phosphorylation	EAPIVRTTTNHPQIV CCCEEEEECCCCCCC	18.29	24894044
108	Phosphorylation	APIVRTTTNHPQIVP CCEEEEECCCCCCCC	30.80	24894044
118	Phosphorylation	PQIVPPPSSVTLDFS CCCCCCCCCCEEECC	43.12	24894044
119	Phosphorylation	QIVPPPSSVTLDFSK CCCCCCCCCEEECCC	25.54	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of WRK11_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of WRK11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of WRK11_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of WRK11_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.