UniProt ID | WNT6_HUMAN | |
---|---|---|
UniProt AC | Q9Y6F9 | |
Protein Name | Protein Wnt-6 | |
Gene Name | WNT6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 365 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
Protein Description | Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. Together with CAV1 may promote chemoresistance of gastric cancer cells to DNA-damaging anthracycline drugs through the activation of the canonical Wnt receptor signaling pathway.. | |
Protein Sequence | MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
86 | N-linked_Glycosylation | QFRFRRWNCSSHSKA EEEECCCCCCHHHHH | 17.62 | UniProtKB CARBOHYD | |
228 | O-palmitoleoylation | ECKCHGLSGSCALRT CCCCCCCCCCCHHHH | 33.00 | - | |
263 | Phosphorylation | GASRVMGTNDGKALL CCCCEECCCCHHHHH | 16.43 | - | |
275 | Phosphorylation | ALLPAVRTLKPPGRA HHHHHHHCCCCCCCC | 32.32 | - | |
302 | Phosphorylation | APNRRTGSPGTRGRA CCCCCCCCCCCCCCC | 21.39 | - | |
311 | N-linked_Glycosylation | GTRGRACNSSAPDLS CCCCCCCCCCCCCCC | 37.71 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WNT6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WNT6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WNT6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of WNT6_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...