UniProt ID | WNK5_ARATH | |
---|---|---|
UniProt AC | Q9SCU5 | |
Protein Name | Probable serine/threonine-protein kinase WNK5 | |
Gene Name | WNK5 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 549 | |
Subcellular Localization | ||
Protein Description | Regulates flowering time by modulating the photoperiod pathway.. | |
Protein Sequence | MYMEISSASDDSIAYVETDPSGRYGRFREVLGKGAMKTVYKAFDQVLGMEVAWNQVKLNEVFRSPEPLQRLYSEVHLLKNLNHESIIRYCTSWIDVNRRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWARQILNGLAYLHGHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAILRGSQNAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTGEYPYSECTNPAQIYKKVTSGKLPDSFHLIQHTEAQRFVGKCLETVSRRLPAKELLADPFLAATDERDLAPLFRLPQQLAIQNLAANGTVVEHLPSTTDPTRTTDMSITGKMNSEDHTIFLQVQILDGDGHMRNIQFPFNILSDTPLEVALEMVKELEITDWDPLEIAAMIENEISLLVPNWRANDSSIRHESFGHEDDEDNGDTEGRTRLFSSASSSHDSPVAVRENNDDSSNDVIPDMDDGNRSSNRLLNSSTYHYSPAIDDDQNQQQRRRVRLQQKMRSLVDTRTQVLHRSLMELINKRRGRGFDPNTNELQPQPSSTDFIRRC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
415 | Phosphorylation | DSSIRHESFGHEDDE CCCCCCCCCCCCCCC | 30.33 | 30407730 | |
468 | Phosphorylation | DMDDGNRSSNRLLNS CCCCCCCCCCCCCCC | 35.64 | 30407730 | |
469 | Phosphorylation | MDDGNRSSNRLLNSS CCCCCCCCCCCCCCC | 23.80 | 30407730 | |
475 | Phosphorylation | SSNRLLNSSTYHYSP CCCCCCCCCCCCCCC | 24.83 | 23328941 | |
476 | Phosphorylation | SNRLLNSSTYHYSPA CCCCCCCCCCCCCCC | 31.73 | 23328941 | |
504 | Phosphorylation | RLQQKMRSLVDTRTQ HHHHHHHHHHHHHHH | 29.28 | - | |
516 | Phosphorylation | RTQVLHRSLMELINK HHHHHHHHHHHHHHH | 22.71 | 30407730 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WNK5_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WNK5_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WNK5_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of WNK5_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...