UniProt ID | WLIM1_ARATH | |
---|---|---|
UniProt AC | Q94JX5 | |
Protein Name | LIM domain-containing protein WLIM1 {ECO:0000305} | |
Gene Name | WLIM1 {ECO:0000303|PubMed:11085265, ECO:0000303|PubMed:17573466} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 190 | |
Subcellular Localization | Cytoplasm, cytoskeleton . | |
Protein Description | Binds to actin filaments and promotes cross-linking into thick bundles. Has an actin-stabilizing activity. The actin regulatory activities are not regulated by pH and [Ca(2+)].. | |
Protein Sequence | MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHHIQLIKEKGNLSQLEGGGENAAKDKVVAA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WLIM1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WLIM1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WLIM1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of WLIM1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...