UniProt ID | WLI2B_ARATH | |
---|---|---|
UniProt AC | Q9M047 | |
Protein Name | LIM domain-containing protein WLIM2b {ECO:0000305} | |
Gene Name | WLIM2B {ECO:0000303|PubMed:17573466} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 199 | |
Subcellular Localization | Cytoplasm, cytoskeleton . | |
Protein Description | Binds to actin filaments and promotes cross-linking into thick bundles. Has an actin-stabilizing activity. The actin regulatory activities are not regulated by pH and [Ca(2+)].. | |
Protein Sequence | MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASIKRSAAAAVAAGVPAASVPES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSFTGTQQK ------CCCCCCHHH | 25561503 | ||
4 | Phosphorylation | ----MSFTGTQQKCK ----CCCCCCHHHHH | 25561503 | ||
6 | Phosphorylation | --MSFTGTQQKCKAC --CCCCCCHHHHHHC | 25561503 | ||
42 | Phosphorylation | FKCTHCKSRLQLSSY HCCCCCCCCEECCCC | 23572148 | ||
71 | Phosphorylation | QLFKESGSFNKNFQS HHHHHHCCCCCCCCC | 30407730 | ||
78 | Phosphorylation | SFNKNFQSPAKSADK CCCCCCCCCCCCCCC | 19880383 | ||
82 | Phosphorylation | NFQSPAKSADKSTPE CCCCCCCCCCCCCCC | 19880383 | ||
91 | Phosphorylation | DKSTPELTRTPSRVA CCCCCCCCCCHHHHC | 29654922 | ||
93 | Phosphorylation | STPELTRTPSRVAGR CCCCCCCCHHHHCCC | 30407730 | ||
95 | Phosphorylation | PELTRTPSRVAGRFS CCCCCCHHHHCCCCC | 19880383 | ||
169 | Phosphorylation | QLFKEKGSYNHLIKS HHHHHHCCHHHHHHH | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WLI2B_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WLI2B_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WLI2B_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of WLI2B_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...