| UniProt ID | WIPI3_MOUSE | |
|---|---|---|
| UniProt AC | Q9CR39 | |
| Protein Name | WD repeat domain phosphoinositide-interacting protein 3 | |
| Gene Name | Wdr45b | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 344 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MNLLPCNPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVGHVEMLFRCNYLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMIKVFTFTHNPHQLHVFETCYNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPPVDIPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTSSGHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHIFAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSGSPCICAFGTEPNAVIAICADGSYYKFLFSPKGECVRDVCAQFLEMTDDKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 206 | Ubiquitination | RIATASEKGTLIRIF EEEEECCCCCEEEEE | 55.49 | 27667366 | |
| 266 | Ubiquitination | AEDPKRNKQSSLASA ECCCCCCCCCCHHCH | 56.44 | 27667366 | |
| 272 | Phosphorylation | NKQSSLASASFLPKY CCCCCHHCHHHCHHH | 29.73 | - | |
| 325 | Ubiquitination | YKFLFSPKGECVRDV EEEEECCCCHHHHHH | 67.17 | - | |
| 340 | Phosphorylation | CAQFLEMTDDKL--- HHHHHHHCCCCC--- | 31.50 | 28576409 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WIPI3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WIPI3_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WIPI3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of WIPI3_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...