UniProt ID | WIPI3_MOUSE | |
---|---|---|
UniProt AC | Q9CR39 | |
Protein Name | WD repeat domain phosphoinositide-interacting protein 3 | |
Gene Name | Wdr45b | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 344 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MNLLPCNPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVGHVEMLFRCNYLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMIKVFTFTHNPHQLHVFETCYNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPPVDIPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTSSGHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHIFAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSGSPCICAFGTEPNAVIAICADGSYYKFLFSPKGECVRDVCAQFLEMTDDKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
206 | Ubiquitination | RIATASEKGTLIRIF EEEEECCCCCEEEEE | 55.49 | 27667366 | |
266 | Ubiquitination | AEDPKRNKQSSLASA ECCCCCCCCCCHHCH | 56.44 | 27667366 | |
272 | Phosphorylation | NKQSSLASASFLPKY CCCCCHHCHHHCHHH | 29.73 | - | |
325 | Ubiquitination | YKFLFSPKGECVRDV EEEEECCCCHHHHHH | 67.17 | - | |
340 | Phosphorylation | CAQFLEMTDDKL--- HHHHHHHCCCCC--- | 31.50 | 28576409 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WIPI3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WIPI3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WIPI3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of WIPI3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...