UniProt ID | WDR74_MOUSE | |
---|---|---|
UniProt AC | Q8VCG3 | |
Protein Name | WD repeat-containing protein 74 | |
Gene Name | Wdr74 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 384 | |
Subcellular Localization | Nucleus, nucleolus. | |
Protein Description | ||
Protein Sequence | MATASARWNHVWVGTETGILKGVNLQRKHAANFTPSGQPRREEAVNALCWGTGGETQILVGCADRTVRYFNAEEGTFLSQRYCPGGEGTFRGLAQADGTLITCVDSGILRVWCENDKEASSDPLLELKVGPGVCRMRQDPTHTHVVATCGKENALKVWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDTQFLPGSQKLVTCTGYHQVRVYDPVSPQRRPVLEATYGEYPLTAMTLTPEGNSVIVGNTHGQLAEIDFRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIRNPRGLEHKVYLKSQLNCLLLSGRDNWEDEPQEPQEPNQVPSEDTETDELWASLEAAAKRKLPDLDQTQGALQRRKKKKRPGSTSP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
214 | Phosphorylation | VRVYDPVSPQRRPVL EEEECCCCCCCCCEE | 22.24 | 28066266 | |
311 | Methylation | LEHKVYLKSQLNCLL CCCEEEHHHHHHEEE | 20.61 | - | |
366 | Phosphorylation | KLPDLDQTQGALQRR CCCCHHHHHHHHHHH | 28.74 | 28066266 | |
381 | Phosphorylation | KKKKRPGSTSP---- HHCCCCCCCCC---- | 28.52 | 23684622 | |
382 | Phosphorylation | KKKRPGSTSP----- HCCCCCCCCC----- | 51.43 | 23684622 | |
383 | Phosphorylation | KKRPGSTSP------ CCCCCCCCC------ | 30.24 | 25266776 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WDR74_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WDR74_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WDR74_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of WDR74_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...