WDR74_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: WDR74_MOUSE
• UniProt AC: Q8VCG3
• Protein Name: WD repeat-containing protein 74
• Gene Name: Wdr74
• Organism: Mus musculus (Mouse).
• Sequence Length: 384
• Subcellular Localization: Nucleus, nucleolus.
• Protein Sequence: MATASARWNHVWVGTETGILKGVNLQRKHAANFTPSGQPRREEAVNALCWGTGGETQILVGCADRTVRYFNAEEGTFLSQRYCPGGEGTFRGLAQADGTLITCVDSGILRVWCENDKEASSDPLLELKVGPGVCRMRQDPTHTHVVATCGKENALKVWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDTQFLPGSQKLVTCTGYHQVRVYDPVSPQRRPVLEATYGEYPLTAMTLTPEGNSVIVGNTHGQLAEIDFRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIRNPRGLEHKVYLKSQLNCLLLSGRDNWEDEPQEPQEPNQVPSEDTETDELWASLEAAAKRKLPDLDQTQGALQRRKKKKRPGSTSP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
214	Phosphorylation	VRVYDPVSPQRRPVL EEEECCCCCCCCCEE	22.24	28066266
311	Methylation	LEHKVYLKSQLNCLL CCCEEEHHHHHHEEE	20.61	-
366	Phosphorylation	KLPDLDQTQGALQRR CCCCHHHHHHHHHHH	28.74	28066266
381	Phosphorylation	KKKKRPGSTSP---- HHCCCCCCCCC----	28.52	23684622
382	Phosphorylation	KKKRPGSTSP----- HCCCCCCCCC-----	51.43	23684622
383	Phosphorylation	KKRPGSTSP------ CCCCCCCCC------	30.24	25266776

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of WDR74_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of WDR74_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of WDR74_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of WDR74_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.