UniProt ID | WBP2_MOUSE | |
---|---|---|
UniProt AC | P97765 | |
Protein Name | WW domain-binding protein 2 | |
Gene Name | Wbp2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 261 | |
Subcellular Localization | Cytoplasm . Nucleus . Translocates from cytoplasm to nucleus when phosphorylated. | |
Protein Description | Acts as transcriptional coactivator of estrogen and progesterone receptors (ESR1 and PGR) upon hormone activation. In presence of estrogen, binds to ESR1-responsive promoters. Required for YAP1 coactivation function on PGR activity. Synergizes with WBP2 in enhancing PGR activity (By similarity). Modulates expression of post-synaptic scaffolding proteins via regulation of ESR1, ESR2 and PGR. [PubMed: 26881968] | |
Protein Sequence | MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANFIKGIVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPNGAYGYPYMPSGAYVFPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPSAPATPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYPPEDKKTQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | O-linked_Glycosylation | VIVNNTESILMSYDH EEECCCCEEEEECCE | 20.98 | 55414593 | |
47 | Malonylation | EAFKGTKKGTVYLTP HHHCCCCCCEEEECC | 60.70 | 26320211 | |
62 | Acetylation | YRVIFLSKGKDAMQS EEEEEECCCHHHHHH | 72.61 | - | |
62 | Acetylation | YRVIFLSKGKDAMQS EEEEEECCCHHHHHH | 72.61 | 22826441 | |
64 | Ubiquitination | VIFLSKGKDAMQSFM EEEECCCHHHHHHCH | 46.15 | - | |
64 | Ubiquitination | VIFLSKGKDAMQSFM EEEECCCHHHHHHCH | 46.15 | - | |
83 | Ubiquitination | LMKDCEIKQPVFGAN HHCCCCCCCCCCCCC | 26.68 | - | |
83 | Acetylation | LMKDCEIKQPVFGAN HHCCCCCCCCCCCCC | 26.68 | - | |
83 | Ubiquitination | LMKDCEIKQPVFGAN HHCCCCCCCCCCCCC | 26.68 | - | |
83 | Acetylation | LMKDCEIKQPVFGAN HHCCCCCCCCCCCCC | 26.68 | 22826441 | |
93 | Acetylation | VFGANFIKGIVKAEA CCCCCCEEEEEEEEE | 38.15 | - | |
93 | Acetylation | VFGANFIKGIVKAEA CCCCCCEEEEEEEEE | 38.15 | 22826441 | |
192 | Phosphorylation | MMDGAMGYVQPPPPP CCCCCCCCCCCCCCC | 5.26 | - | |
231 | Phosphorylation | AEAAASAYYNPGNPH HHHHHHHHCCCCCCC | 10.98 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WBP2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WBP2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WBP2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NEDD4_MOUSE | Nedd4 | physical | 11042109 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...