VTI13_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VTI13_ARATH
• UniProt AC: Q9LVP9
• Protein Name: Vesicle transport v-SNARE 13
• Gene Name: VTI13
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 221
• Subcellular Localization: Membrane; Single-pass type IV membrane protein.
• Protein Description: May function as a v-SNARE responsible for targeting vesicles involved in the secretory pathway..
• Protein Sequence: MSQGFERYERQYCEISANLSKKCTSAIALDGEQKKQNLSEIKSGVEEAEALVKKMDLEARNLPPNVKSSLLVKLREYKSDLNNFKTEVKRITSGNLNATARDELLEAGMADTLTASADQRSRLMMSTDHLGRTTDRIKDSRRTILETEELGVSILQDLHGQRQSLLRAHETLHGVDDNVGKSKKILTTMTRRMNRNKWTIGAIITVLVLAIIFILYFKLTR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
171	Phosphorylation	SLLRAHETLHGVDDN HHHHHHHHHHCCCCC	17.75	23111157
187	Phosphorylation	GKSKKILTTMTRRMN CCHHHHHHHHHHHHH	20.28	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VTI13_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VTI13_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VTI13_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of VTI13_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.