VTC1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VTC1_SCHPO
• UniProt AC: Q9UR17
• Protein Name: Vacuolar transporter chaperone 1
• Gene Name: nrf1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 122
• Subcellular Localization: Vacuole membrane ; Multi-pass membrane protein .
• Protein Description: Component of the vacuolar transporter chaperone (VTC) complex, which plays a role in vacuolar membrane fusion (By similarity). Involved in the control of cell polarity..
• Protein Sequence: MSTQPLLQTTPGKRIALPVRVEPKVFFANERTFLSWLSFAVVLGGLSVGLLNFGDRIGKISAGLFTIVAIGTMGYALGIYHWRASAIRRRGSGPYDDRLGPTILCFVLLAAIITNFVLRMLF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSTQPLLQT ------CCCCCCCCC	35.43	29996109
3	Phosphorylation	-----MSTQPLLQTT -----CCCCCCCCCC	32.67	29996109
9	Phosphorylation	STQPLLQTTPGKRIA CCCCCCCCCCCCEEE	34.62	28889911
10	Phosphorylation	TQPLLQTTPGKRIAL CCCCCCCCCCCEEEE	19.65	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VTC1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VTC1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VTC1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC42_SCHPO	cdc42	genetic	10628977
CDC42_SCHPO	cdc42	genetic	11042180

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.