UniProt ID | VTC1_SCHPO | |
---|---|---|
UniProt AC | Q9UR17 | |
Protein Name | Vacuolar transporter chaperone 1 | |
Gene Name | nrf1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 122 | |
Subcellular Localization |
Vacuole membrane Multi-pass membrane protein . |
|
Protein Description | Component of the vacuolar transporter chaperone (VTC) complex, which plays a role in vacuolar membrane fusion (By similarity). Involved in the control of cell polarity.. | |
Protein Sequence | MSTQPLLQTTPGKRIALPVRVEPKVFFANERTFLSWLSFAVVLGGLSVGLLNFGDRIGKISAGLFTIVAIGTMGYALGIYHWRASAIRRRGSGPYDDRLGPTILCFVLLAAIITNFVLRMLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSTQPLLQT ------CCCCCCCCC | 35.43 | 29996109 | |
3 | Phosphorylation | -----MSTQPLLQTT -----CCCCCCCCCC | 32.67 | 29996109 | |
9 | Phosphorylation | STQPLLQTTPGKRIA CCCCCCCCCCCCEEE | 34.62 | 28889911 | |
10 | Phosphorylation | TQPLLQTTPGKRIAL CCCCCCCCCCCEEEE | 19.65 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VTC1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VTC1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VTC1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDC42_SCHPO | cdc42 | genetic | 10628977 | |
CDC42_SCHPO | cdc42 | genetic | 11042180 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...