UniProt ID | VTA1_MOUSE | |
---|---|---|
UniProt AC | Q9CR26 | |
Protein Name | Vacuolar protein sorting-associated protein VTA1 homolog | |
Gene Name | Vta1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 309 | |
Subcellular Localization |
Cytoplasm . Endosome membrane Peripheral membrane protein . |
|
Protein Description | Involved in the endosomal multivesicular bodies (MVB) pathway. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. Thought to be a cofactor of VPS4A/B, which catalyzes disassembles membrane-associated ESCRT-III assemblies (By similarity). Involved in the sorting and down-regulation of EGFR.. | |
Protein Sequence | MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAVTQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEENDVEENEDVGATSLPTQPPQPSSSSAYDPSNLAPGSYSGIQIPPGAHAPANTPAEVPHSTGVTSNAVQPSPQTVPAAPAVDPDLYTASQGDIRLTPEDFARAQKYCKYAGSALQYEDVGTAVQNLQKALRLLTTGRE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAALAPLPP ------CCCCCCCCC | 15.93 | - | |
15 | Acetylation | PPLPAQFKSIQHHLR CCCCHHHHHHHHHHH | 34.27 | 22902405 | |
52 | Malonylation | TGMKIDSKTPECRKF HCCCCCCCCHHHHHH | 65.44 | 32601280 | |
62 | Acetylation | ECRKFLSKLMDQLEA HHHHHHHHHHHHHHH | 50.40 | 22902405 | |
116 | Acetylation | RFHKNMIKSFYTASL HHCHHHHHHHHHHHH | 24.60 | 19845091 | |
140 | Acetylation | ELTDENVKHRKYARW HCCCCCHHCHHHHHH | 49.64 | 19845099 | |
155 | Glutathionylation | KATYIHNCLKNGETP HHHHHHHHHHCCCCC | 3.37 | 24333276 | |
277 | Phosphorylation | DFARAQKYCKYAGSA HHHHHHHHHHHCCCC | 5.10 | 20139300 | |
280 | Phosphorylation | RAQKYCKYAGSALQY HHHHHHHHCCCCCCC | 16.78 | 25619855 | |
283 | Phosphorylation | KYCKYAGSALQYEDV HHHHHCCCCCCCCCH | 20.03 | 25619855 | |
287 | Phosphorylation | YAGSALQYEDVGTAV HCCCCCCCCCHHHHH | 18.23 | 25619855 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VTA1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VTA1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VTA1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VTA1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...