dbPTM

VPS92_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VPS92_SCHPO
UniProt AC	O94388
Protein Name	Vacuolar protein sorting-associated protein 9b
Gene Name	vps902
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	402
Subcellular Localization	Cytoplasm .
Protein Description
Protein Sequence	MSFLNSWRAVKYTNKPKEEDIKLPNSASNLPTTVQACVIQFISSLVSPVHPQLLSPEELAKAFQNFYKHTDEFIASTLIPQPSSKDQNVPLLFPEEIDAQKKARQHLLNQKDEWMDQIEDIVCEYLYDRIFCLSTSTDAAKDDLLKKFIASEEKKELINCIPIPDDEKLTNRLHEVSEAFFALDEQHTPRSKINTFMTVNSSILNASQLPQEELNADSLLNLTIYCILCYPGFHLISHLNFVLRFRNADFLSGEQRYCLTTFEAALTFILRACPNLLTQSSIQPSDDPLSLEVANSETVSTSNSLHDPSAEPYPVNRSSLSNLRNLGLALEKSYASLLSKVANHTAKSSEDSSNSVEFVGDPPLERFLTVSDASDLKIGEIELLLSDYKRLARLLFEKNGNQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
319	Phosphorylation	PYPVNRSSLSNLRNL CCCCCHHHHHHHHHH	32.36	25720772
333	Phosphorylation	LGLALEKSYASLLSK HHHHHHHHHHHHHHH	19.29	24763107
334	Phosphorylation	GLALEKSYASLLSKV HHHHHHHHHHHHHHH	15.98	25720772
336	Phosphorylation	ALEKSYASLLSKVAN HHHHHHHHHHHHHHH	22.93	24763107
349	Phosphorylation	ANHTAKSSEDSSNSV HHHHCCCCCCCCCCE	44.72	25720772
353	Phosphorylation	AKSSEDSSNSVEFVG CCCCCCCCCCEEECC	45.50	25720772
355	Phosphorylation	SSEDSSNSVEFVGDP CCCCCCCCEEECCCC	25.60	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VPS92_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VPS92_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VPS92_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of VPS92_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VPS92_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-355, AND MASSSPECTROMETRY.	18257517 [Abstract]