UniProt ID | VPS4A_MOUSE | |
---|---|---|
UniProt AC | Q8VEJ9 | |
Protein Name | Vacuolar protein sorting-associated protein 4A | |
Gene Name | Vps4a {ECO:0000312|EMBL:AAH18368.1, ECO:0000312|MGI:MGI:1890520} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 437 | |
Subcellular Localization |
Prevacuolar compartment membrane Peripheral membrane protein . Late endosome membrane Peripheral membrane protein. Midbody. Membrane-associated in the prevacuolar endosomal compartment. Localizes to the midbody of dividing cells. Localizes to the |
|
Protein Description | Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Involved in cytokinesis: retained at the midbody by ZFYVE19/ANCHR and CHMP4C until abscission checkpoint signaling is terminated at late cytokinesis. It is then released following dephosphorylation of CHMP4C, leading to abscission. VPS4A/B are required for the exosomal release of SDCBP, CD63 and syndecan (By similarity).. | |
Protein Sequence | MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCMQYLDRAEKLKDYLRNKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSVMIDDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Acetylation | MTTSTLQKAIDLVTK CCHHHHHHHHHHHHH | 50.88 | - | |
51 | Acetylation | KYEAHSDKAKESIRA HHHHCCHHHHHHHHH | 65.46 | 23806337 | |
90 | Phosphorylation | KPVKENQSEGKGSDS CCCCCCCCCCCCCCC | 60.96 | 21149613 | |
95 | Phosphorylation | NQSEGKGSDSDSEGD CCCCCCCCCCCCCCC | 37.11 | 25521595 | |
97 | Phosphorylation | SEGKGSDSDSEGDNP CCCCCCCCCCCCCCH | 44.74 | 25521595 | |
99 | Phosphorylation | GKGSDSDSEGDNPEK CCCCCCCCCCCCHHH | 47.64 | 25521595 | |
140 | Ubiquitination | EGAKEALKEAVILPI HHHHHHHHHCCEEEE | 51.15 | 27667366 | |
156 | Ubiquitination | FPHLFTGKRTPWRGI CCCCCCCCCCCCEEE | 50.47 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPS4A_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPS4A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPS4A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VPS4A_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...