dbPTM

VPS36_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VPS36_SCHPO
UniProt AC	O43038
Protein Name	Vacuolar protein-sorting-associated protein 36
Gene Name	vps36
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	467
Subcellular Localization	Cytoplasm . Golgi apparatus .
Protein Description	Component of the ESCRT-II complex, which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. Its ability to bind ubiquitin plays a central role in endosomal sorting of ubiquitinated cargo proteins by the ESCRT complexes (By similarity). Required for vacuolar sorting of carboxypeptidase S (CPS)..
Protein Sequence	MAFYLETTPSNLPVLDPSEEILLVQDQVGLYFGDEKSFRHNNGTLYLTKKHIFYVDSVDPKKNSLKIKISDIRDVQHTSRYFRSSPKIRLSLRHVEKSWACKICTFINVGDPINPCRNCGVANRFTIIKPKSDARFSQGLCTACTFQNYPDLNTCEICGNQLKNVDRNQLIQLSFRGSGSSKFYEAIKSETDEIEKQRYSNKYDTKVLRKAILEKSLRMGGIHDLEQSHEMQLAKNGRTLVHAFQDLDAFFSLAKDTMSLADQFAEKMDGLTGTQQSDKVQQLLNKSNQLGVLRGNHLDNVPVSANSRLYDIELCKSISEVLRTRLKADTDTVTMTQAWAIYNRSRKANLIPPTRFVKACELIDSMEVGITTSKMNSGLILFQLKTSNHSGKLLSAILEVMNPSTTALKCAMRLHWSIGVTLERLYQAEMDGYIVRDVYEESGSSLLYWKNEFDELSEELTKWFDES

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of VPS36_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VPS36_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VPS36_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VPS36_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ELP3_SCHPO	elp3	genetic	19547744

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VPS36_SCHPO

Related Literatures of Post-Translational Modification