UniProt ID | VPS26_SCHPO | |
---|---|---|
UniProt AC | Q10243 | |
Protein Name | Vacuolar protein sorting-associated protein 26 | |
Gene Name | vps26 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 298 | |
Subcellular Localization | ||
Protein Description | Plays a role in vesicular protein sorting. Required for the endosome-to-Golgi retrieval of the vacuolar protein sorting receptor pep1/vps10. Component of the membrane-associated retromer complex which is essential in endosome-to-Golgi retrograde transport. The vps29-vps26-vps35 subcomplex may be involved in cargo selection.. | |
Protein Sequence | MDYFFKSPIDVDLHLDNEEERTFVDYEFEQGRKDKAPIYESDETVKGTVMIRLKDGRKLDHDGVKIEFIGQIENTYDKGNIHEFTRSVQELASPGEMRHAQMFEFEFKHVDKPYESYIGKNVKLRYICRVTVSRKMKDVIREKDLWVYRFENEPETNSLIRMDVGIDECLHIEFEYSKNKYHLKDVIIGKIYFILVRIKVQRMEVSIIRRETIGTSPNQYSNSETITRFQIMDGNPNRGETIPLRMFLNGYALTPTFRDVNKKFSVRYYLSLILVDEDQRRYFKQSEITLWRRRDEHE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of VPS26_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPS26_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPS26_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPS26_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VPS26_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...