UniProt ID | VPS24_SCHPO | |
---|---|---|
UniProt AC | O14296 | |
Protein Name | Vacuolar protein sorting-associated protein 24 | |
Gene Name | vps24 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 231 | |
Subcellular Localization |
Endosome membrane Peripheral membrane protein. Endomembrane system Peripheral membrane protein. |
|
Protein Description | Class E VPS protein implicated in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles. The lumenal sequestrated membrane proteins will be targeted into the vacuole after fusion of the endosome with the vacuole.. | |
Protein Sequence | MQTVRSYFFGPTPQEQNRKWQSIIRKEQRQLDRQVYHLKAGRKKAEVQLKQLAKQSDITNMRILAKEIARANRHGKRLAESKALLGSLSLQLNDQMAMLKIQGTMQSSTKIMQDVSSLIRLPQLSETMRNLSMELTKAGVLEEMRDEMFLPVEDDEELMDLADEDEEVQEILTKYNVIPAPSEKAADAATHREQSLKQALPSLSNGIAKDSTEIDEEQLLDIRDKLDALKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MQTVRSYFFG -----CCCCHHHHCC | 19.31 | 24763107 | |
190 | Phosphorylation | EKAADAATHREQSLK HHHHHHHHHHHHHHH | 24.16 | 21712547 | |
195 | Phosphorylation | AATHREQSLKQALPS HHHHHHHHHHHHHHH | 32.55 | 24763107 | |
202 | Phosphorylation | SLKQALPSLSNGIAK HHHHHHHHHHCCCCC | 45.33 | 21712547 | |
204 | Phosphorylation | KQALPSLSNGIAKDS HHHHHHHHCCCCCCC | 37.03 | 21712547 | |
211 | Phosphorylation | SNGIAKDSTEIDEEQ HCCCCCCCCCCCHHH | 27.51 | 24763107 | |
212 | Phosphorylation | NGIAKDSTEIDEEQL CCCCCCCCCCCHHHH | 47.28 | 29996109 | |
231 | Phosphorylation | DKLDALKS------- HHHHHHHC------- | 46.43 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPS24_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPS24_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPS24_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VPS24_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...