dbPTM

VP37A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VP37A_MOUSE
UniProt AC	Q8CHS8
Protein Name	Vacuolar protein sorting-associated protein 37A
Gene Name	Vps37a
Organism	Mus musculus (Mouse).
Sequence Length	397
Subcellular Localization	Late endosome membrane Peripheral membrane protein. Nucleus.
Protein Description	Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation (By similarity)..
Protein Sequence	MSWLFPLAKSASSSAAGSPAGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNNLTININILLPPQFPQEKPVISVYPPIRHHLMDSQGLYVTSPLVSNFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTTFPYLYSNPGGMPPYPSQGFPFLPPYPPPEANRNITSLSVADTVSSSTTSYTAAKPVAPSFGILSSLPLPVPTTESSASVNQNGFGYKMPDIPDAFPELSELSVSQLTDMNEQEEVLLEQFLMLPQLKQIITDKEDLVKNIEELARKNLLLEHSLEGKRQTVLDKYELLLQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEIDDFLNSFKEKRTICHCRRAKEEKLHQVIAMHSQFHAPL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	WLFPLAKSASSSAAG CCHHHCCCCCCCCCC	27.98	26643407
12	Phosphorylation	FPLAKSASSSAAGSP HHHCCCCCCCCCCCC	31.73	26643407
13	Phosphorylation	PLAKSASSSAAGSPA HHCCCCCCCCCCCCC	24.58	28066266
14	Phosphorylation	LAKSASSSAAGSPAG HCCCCCCCCCCCCCC	21.46	28066266
18	Phosphorylation	ASSSAAGSPAGLTSL CCCCCCCCCCCCHHH	13.57	28066266
29	Ubiquitination	LTSLQQQKQRLIESL CHHHHHHHHHHHHHH	32.80	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VP37A_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VP37A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VP37A_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of VP37A_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VP37A_MOUSE

Related Literatures of Post-Translational Modification