UniProt ID | VN1R5_HUMAN | |
---|---|---|
UniProt AC | Q7Z5H4 | |
Protein Name | Vomeronasal type-1 receptor 5 | |
Gene Name | VN1R5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 357 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Putative pheromone receptor.. | |
Protein Sequence | MLKLVIIENMAEIMLFSLDLLLFSTDILCFNFPSKMIKLPGFITIQIFFYPQASFGISANTILLLFHIFTFVFSHRSKSIDMIISHLSLIHILLLFTQAILVSLDFFGSQNTQDDLRYKVIVFLNKVMRGLSICTPCLLSVLQAIISPSIFSLAKLKHPSASHILGFFLFSWVLNMFIGVIFCCTLRLPPVKRGQSSVCHTALFLFAHELHPQETVFHTNDFEGCHLYRVHGPLKRLHGDYFIQTIRGYLSAFTQPACPRVSPVKRASQAILLLVSFVFTYWVDFTFSFSGGVTWINDSLLVWLQVIVANSYAAISPLMLIYADNQIFKTLQMLWFKYLSPPKLMLKFNRQCGSTKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
152 | Phosphorylation | IISPSIFSLAKLKHP HHCHHHHHHHHCCCC | 26.25 | 25954137 | |
297 | N-linked_Glycosylation | SGGVTWINDSLLVWL CCCEEEECHHHHHHH | 25.12 | UniProtKB CARBOHYD | |
338 | Phosphorylation | LQMLWFKYLSPPKLM HHHHHHHHCCCCHHH | 11.70 | 18083107 | |
340 | Phosphorylation | MLWFKYLSPPKLMLK HHHHHHCCCCHHHHH | 35.75 | 24719451 | |
354 | Phosphorylation | KFNRQCGSTKK---- HHHHHCCCCCC---- | 44.68 | - | |
355 | Phosphorylation | FNRQCGSTKK----- HHHHCCCCCC----- | 28.30 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VN1R5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VN1R5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VN1R5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VN1R5_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...