| UniProt ID | VN1R5_HUMAN | |
|---|---|---|
| UniProt AC | Q7Z5H4 | |
| Protein Name | Vomeronasal type-1 receptor 5 | |
| Gene Name | VN1R5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 357 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
| Protein Description | Putative pheromone receptor.. | |
| Protein Sequence | MLKLVIIENMAEIMLFSLDLLLFSTDILCFNFPSKMIKLPGFITIQIFFYPQASFGISANTILLLFHIFTFVFSHRSKSIDMIISHLSLIHILLLFTQAILVSLDFFGSQNTQDDLRYKVIVFLNKVMRGLSICTPCLLSVLQAIISPSIFSLAKLKHPSASHILGFFLFSWVLNMFIGVIFCCTLRLPPVKRGQSSVCHTALFLFAHELHPQETVFHTNDFEGCHLYRVHGPLKRLHGDYFIQTIRGYLSAFTQPACPRVSPVKRASQAILLLVSFVFTYWVDFTFSFSGGVTWINDSLLVWLQVIVANSYAAISPLMLIYADNQIFKTLQMLWFKYLSPPKLMLKFNRQCGSTKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 152 | Phosphorylation | IISPSIFSLAKLKHP HHCHHHHHHHHCCCC | 26.25 | 25954137 | |
| 297 | N-linked_Glycosylation | SGGVTWINDSLLVWL CCCEEEECHHHHHHH | 25.12 | UniProtKB CARBOHYD | |
| 338 | Phosphorylation | LQMLWFKYLSPPKLM HHHHHHHHCCCCHHH | 11.70 | 18083107 | |
| 340 | Phosphorylation | MLWFKYLSPPKLMLK HHHHHHCCCCHHHHH | 35.75 | 24719451 | |
| 354 | Phosphorylation | KFNRQCGSTKK---- HHHHHCCCCCC---- | 44.68 | - | |
| 355 | Phosphorylation | FNRQCGSTKK----- HHHHCCCCCC----- | 28.30 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VN1R5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VN1R5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VN1R5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of VN1R5_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...