VKOR1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VKOR1_MOUSE
• UniProt AC: Q9CRC0
• Protein Name: Vitamin K epoxide reductase complex subunit 1
• Gene Name: Vkorc1
• Organism: Mus musculus (Mouse).
• Sequence Length: 161
• Subcellular Localization: Endoplasmic reticulum membrane; Multi-pass membrane protein.
• Protein Description: Involved in vitamin K metabolism. Catalytic subunit of the vitamin K epoxide reductase (VKOR) complex which reduces inactive vitamin K 2,3-epoxide to active vitamin K. Vitamin K is required for the gamma-carboxylation of various proteins, including clotting factors, and is required for normal blood coagulation, but also for normal bone development..
• Protein Sequence: MGTTWRSPGLVRLALCLAGLALSLYALHVKAARARDENYRALCDVGTAISCSRVFSSRWGRGFGLVEHMLGADSVLNQSNSIFGCLFYTLQLLLGCLRGRWASILLVLSSLVSVAGSVYLAWILFFVLYDFCIVCITTYAINVGLMLLSFQKVPEHKTKKH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	S-palmitoylation	DENYRALCDVGTAIS CCCHHHHHHHHHHHH	3.78	28526873
51	Glutathionylation	DVGTAISCSRVFSSR HHHHHHHHHHHHCCC	2.17	24333276
51	S-palmitoylation	DVGTAISCSRVFSSR HHHHHHHHHHHHCCC	2.17	28526873

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VKOR1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VKOR1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VKOR1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of VKOR1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.