UniProt ID | VKOR1_MOUSE | |
---|---|---|
UniProt AC | Q9CRC0 | |
Protein Name | Vitamin K epoxide reductase complex subunit 1 | |
Gene Name | Vkorc1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 161 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
Protein Description | Involved in vitamin K metabolism. Catalytic subunit of the vitamin K epoxide reductase (VKOR) complex which reduces inactive vitamin K 2,3-epoxide to active vitamin K. Vitamin K is required for the gamma-carboxylation of various proteins, including clotting factors, and is required for normal blood coagulation, but also for normal bone development.. | |
Protein Sequence | MGTTWRSPGLVRLALCLAGLALSLYALHVKAARARDENYRALCDVGTAISCSRVFSSRWGRGFGLVEHMLGADSVLNQSNSIFGCLFYTLQLLLGCLRGRWASILLVLSSLVSVAGSVYLAWILFFVLYDFCIVCITTYAINVGLMLLSFQKVPEHKTKKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
43 | S-palmitoylation | DENYRALCDVGTAIS CCCHHHHHHHHHHHH | 3.78 | 28526873 | |
51 | Glutathionylation | DVGTAISCSRVFSSR HHHHHHHHHHHHCCC | 2.17 | 24333276 | |
51 | S-palmitoylation | DVGTAISCSRVFSSR HHHHHHHHHHHHCCC | 2.17 | 28526873 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VKOR1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VKOR1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VKOR1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VKOR1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...