UniProt ID | VGLL3_HUMAN | |
---|---|---|
UniProt AC | A8MV65 | |
Protein Name | Transcription cofactor vestigial-like protein 3 | |
Gene Name | VGLL3 {ECO:0000312|Ensembl:ENSP00000381436} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 326 | |
Subcellular Localization | Nucleus . | |
Protein Description | May act as a specific coactivator for the mammalian TEFs.. | |
Protein Sequence | MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | Ubiquitination | PQPGQQKKLAVFSKM CCCCCHHHHHHHHCC | 37.02 | 29967540 | |
54 | Phosphorylation | VFSKMQDSLEVTLPS HHHCCCCEEEEECCC | 14.99 | 29507054 | |
61 | Phosphorylation | SLEVTLPSKQEEEDE EEEEECCCCCCHHHH | 50.51 | 24719451 | |
62 | Sumoylation | LEVTLPSKQEEEDEE EEEECCCCCCHHHHH | 60.84 | 28112733 | |
115 | Phosphorylation | RALGQAITLHPESAI HHHHHHHCCCHHHHH | 23.25 | - | |
124 | Ubiquitination | HPESAISKSKMGLTP CHHHHHCHHHCCCCC | 48.24 | 29967540 | |
126 | Acetylation | ESAISKSKMGLTPLW HHHHCHHHCCCCCCC | 40.50 | 30593345 | |
126 | Sumoylation | ESAISKSKMGLTPLW HHHHCHHHCCCCCCC | 40.50 | - | |
126 | Sumoylation | ESAISKSKMGLTPLW HHHHCHHHCCCCCCC | 40.50 | 28112733 | |
307 | Phosphorylation | GTVDIVPSVGFDTGL CEEEECCCCCCCCCC | 24.79 | 25332170 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VGLL3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VGLL3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VGLL3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VGLL3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...