UniProt ID | VGLL2_HUMAN | |
---|---|---|
UniProt AC | Q8N8G2 | |
Protein Name | Transcription cofactor vestigial-like protein 2 | |
Gene Name | VGLL2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 317 | |
Subcellular Localization | Nucleus. | |
Protein Description | May act as a specific coactivator for the mammalian TEFs. May play a role in the development of skeletal muscles.. | |
Protein Sequence | MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTPASIKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKAPRSSGPWRDCSFPMSQRSFPASFWNSAYQAPVPPPLGSPLATAHSELPFAAADPYSPAALHGHLHQGATEPWHHAHPHHAHPHHPYALGGALGAQAAPYPRPAAVHEVYAPHFDPRYGPLLMPAASGRPARLATAPAPAPGSPPCELSGKGEPAGAAWAGPGGPFASPSGDVAQGLGLSVDSARRYSLCGASLLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSCLDVMYQ ------CCHHHHHHH | 24.32 | 24043423 | |
8 | Phosphorylation | MSCLDVMYQVYGPPQ CCHHHHHHHHHCCCC | 8.48 | 24043423 | |
11 | Phosphorylation | LDVMYQVYGPPQPYF HHHHHHHHCCCCCCC | 14.37 | 24043423 | |
17 | Phosphorylation | VYGPPQPYFAAAYTP HHCCCCCCCEEECCH | 10.70 | 24043423 | |
22 | Phosphorylation | QPYFAAAYTPYHQKL CCCCEEECCHHHHHH | 11.97 | 24043423 | |
23 | Phosphorylation | PYFAAAYTPYHQKLA CCCEEECCHHHHHHH | 16.79 | 24043423 | |
25 | Phosphorylation | FAAAYTPYHQKLAYY CEEECCHHHHHHHHH | 14.75 | 24043423 | |
44 | Phosphorylation | EAQECNASPSSSGSG HHHHCCCCCCCCCCC | 16.01 | - | |
53 | Phosphorylation | SSSGSGSSSFSSQTP CCCCCCCCCCCCCCC | 38.64 | - | |
56 | Phosphorylation | GSGSSSFSSQTPASI CCCCCCCCCCCCCCC | 24.39 | - | |
59 | Phosphorylation | SSSFSSQTPASIKEE CCCCCCCCCCCCCCC | 23.83 | - | |
69 | Phosphorylation | SIKEEEGSPEKERPP CCCCCCCCCCCCCCC | 32.92 | 30266825 | |
97 | Phosphorylation | YFQGDISSVVDEHFS EECCCHHHHHHHHHH | 26.88 | - | |
104 | Phosphorylation | SVVDEHFSRALSQPS HHHHHHHHHHHHCCC | 20.67 | 24275569 | |
108 | Phosphorylation | EHFSRALSQPSSYSP HHHHHHHHCCCCCCC | 38.77 | 24275569 | |
111 | Phosphorylation | SRALSQPSSYSPSCT HHHHHCCCCCCCCCC | 33.98 | 24275569 | |
112 | Phosphorylation | RALSQPSSYSPSCTS HHHHCCCCCCCCCCC | 35.99 | 24275569 | |
113 | Phosphorylation | ALSQPSSYSPSCTSS HHHCCCCCCCCCCCC | 29.01 | 24275569 | |
114 | Phosphorylation | LSQPSSYSPSCTSSK HHCCCCCCCCCCCCC | 16.57 | 24275569 | |
133 | Phosphorylation | SGPWRDCSFPMSQRS CCCCCCCCCCCCCCC | 36.35 | - | |
248 | Phosphorylation | PLLMPAASGRPARLA CCEEECCCCCCCEEE | 37.12 | - | |
264 | Phosphorylation | APAPAPGSPPCELSG CCCCCCCCCCCCCCC | 25.30 | 30266825 | |
270 | Phosphorylation | GSPPCELSGKGEPAG CCCCCCCCCCCCCCC | 19.03 | 30266825 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VGLL2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VGLL2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VGLL2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VGLL2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...