UniProt ID | VCY1_HUMAN | |
---|---|---|
UniProt AC | O14598 | |
Protein Name | Testis-specific basic protein Y 1 | |
Gene Name | VCY | |
Organism | Homo sapiens (Human). | |
Sequence Length | 125 | |
Subcellular Localization | ||
Protein Description | May mediate a process in spermatogenesis or may play a role in sex ratio distortion.. | |
Protein Sequence | MSPKPRASGPPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSKGRPSTPLSP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSPKPRASG ------CCCCCCCCC | 41.45 | 30631047 | |
8 | Phosphorylation | MSPKPRASGPPAKAK CCCCCCCCCCCHHHH | 53.78 | 28102081 | |
22 | Phosphorylation | KETGKRKSSSQPSPS HHHCCCCCCCCCCCC | 38.97 | 25072903 | |
23 | Phosphorylation | ETGKRKSSSQPSPSG HHCCCCCCCCCCCCC | 35.71 | 25072903 | |
24 | Phosphorylation | TGKRKSSSQPSPSGP HCCCCCCCCCCCCCC | 53.88 | 25072903 | |
27 | Phosphorylation | RKSSSQPSPSGPKKK CCCCCCCCCCCCCCC | 24.86 | 28102081 | |
29 | Phosphorylation | SSSQPSPSGPKKKTT CCCCCCCCCCCCCCC | 72.56 | 28102081 | |
34 | Acetylation | SPSGPKKKTTKVAEK CCCCCCCCCCCHHHH | 68.50 | 60611811 | |
37 | Acetylation | GPKKKTTKVAEKGEA CCCCCCCCHHHHCCH | 44.68 | 60611813 | |
120 | Phosphorylation | PLSKGRPSTPLSP-- CHHCCCCCCCCCC-- | 41.10 | 23090842 | |
121 | Phosphorylation | LSKGRPSTPLSP--- HHCCCCCCCCCC--- | 30.82 | 22617229 | |
124 | Phosphorylation | GRPSTPLSP------ CCCCCCCCC------ | 29.75 | 20815410 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VCY1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VCY1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VCY1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VCY1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...