| UniProt ID | VCY1_HUMAN |   | 
														
|---|---|---|
| UniProt AC | O14598 | |
| Protein Name | Testis-specific basic protein Y 1 | |
| Gene Name | VCY | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 125 | |
| Subcellular Localization | ||
| Protein Description | May mediate a process in spermatogenesis or may play a role in sex ratio distortion.. | |
| Protein Sequence | MSPKPRASGPPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSKGRPSTPLSP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
| 
																 | 
														||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure  | 
														ASA (%) | Reference | Orthologous Protein Cluster  | 
			    									
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSPKPRASG ------CCCCCCCCC  | 41.45 | 30631047 | |
| 8 | Phosphorylation | MSPKPRASGPPAKAK CCCCCCCCCCCHHHH  | 53.78 | 28102081 | |
| 22 | Phosphorylation | KETGKRKSSSQPSPS HHHCCCCCCCCCCCC  | 38.97 | 25072903 | |
| 23 | Phosphorylation | ETGKRKSSSQPSPSG HHCCCCCCCCCCCCC  | 35.71 | 25072903 | |
| 24 | Phosphorylation | TGKRKSSSQPSPSGP HCCCCCCCCCCCCCC  | 53.88 | 25072903 | |
| 27 | Phosphorylation | RKSSSQPSPSGPKKK CCCCCCCCCCCCCCC  | 24.86 | 28102081 | |
| 29 | Phosphorylation | SSSQPSPSGPKKKTT CCCCCCCCCCCCCCC  | 72.56 | 28102081 | |
| 34 | Acetylation | SPSGPKKKTTKVAEK CCCCCCCCCCCHHHH  | 68.50 | 60611811 | |
| 37 | Acetylation | GPKKKTTKVAEKGEA CCCCCCCCHHHHCCH  | 44.68 | 60611813 | |
| 120 | Phosphorylation | PLSKGRPSTPLSP-- CHHCCCCCCCCCC--  | 41.10 | 23090842 | |
| 121 | Phosphorylation | LSKGRPSTPLSP--- HHCCCCCCCCCC---  | 30.82 | 22617229 | |
| 124 | Phosphorylation | GRPSTPLSP------ CCCCCCCCC------  | 29.75 | 20815410 | 
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources | 
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VCY1_HUMAN !!  | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VCY1_HUMAN !!  | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10)  | 
                            							Residue Change | SAP | Related Disease | Reference | 
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VCY1_HUMAN !!  | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions | 
|---|---|---|---|---|
Oops, there are no PPI records of VCY1_HUMAN !!  | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...