dbPTM

VATL_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VATL_MOUSE
UniProt AC	P63082
Protein Name	V-type proton ATPase 16 kDa proteolipid subunit
Gene Name	Atp6v0c
Organism	Mus musculus (Mouse).
Sequence Length	155
Subcellular Localization	Vacuole membrane Multi-pass membrane protein.
Protein Description	Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells..
Protein Sequence	MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	DIKNNPEYSSFFGVM CCCCCHHHHHHHCCC	15.75	25293948
11	Phosphorylation	IKNNPEYSSFFGVMG CCCCHHHHHHHCCCC	21.00	25293948
12	Phosphorylation	KNNPEYSSFFGVMGA CCCHHHHHHHCCCCH	24.56	25293948
20	Phosphorylation	FFGVMGASSAMVFSA HHCCCCHHHHHHHHH	16.95	25293948
21	Phosphorylation	FGVMGASSAMVFSAM HCCCCHHHHHHHHHH	21.61	25293948
26	Phosphorylation	ASSAMVFSAMGAAYG HHHHHHHHHHHHHHC	13.11	25293948
32	Phosphorylation	FSAMGAAYGTAKSGT HHHHHHHHCCCCCCC	17.93	25293948
34	Phosphorylation	AMGAAYGTAKSGTGI HHHHHHCCCCCCCCC	20.45	25293948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	Rnf182	Q8C432	PMID:22199232

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VATL_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VATL_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of VATL_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VATL_MOUSE

Related Literatures of Post-Translational Modification