VATL_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VATL_DROME
• UniProt AC: P23380
• Protein Name: V-type proton ATPase 16 kDa proteolipid subunit
• Gene Name: Vha16-1
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 159
• Subcellular Localization: Vacuole membrane; Multi-pass membrane protein.
• Protein Description: Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells..
• Protein Sequence: MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of VATL_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VATL_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VATL_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VATL_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.