dbPTM

VATH_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VATH_ARATH
UniProt AC	Q9LX65
Protein Name	V-type proton ATPase subunit H
Gene Name	VHA-H
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	441
Subcellular Localization	Vacuole membrane Peripheral membrane protein .
Protein Description	Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit H activates the ATPase activity of the enzyme and couples ATPase activity to proton flow. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system (By similarity)..
Protein Sequence	MDQAELSIEQVLKRDIPWETYMNTKLVSAKGLQLLRRYDKKPESARAQLLDEDGPAYVHLFVSILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLANEDTYEPFLRLLWKGNWFIQEKSCKILAWIISARPKAGNAVIGNGIDDVLKGLVEWLCAQLKQPSHPTRGVPIAISCLSSLLKEPVVRSSFVQADGVKLLVPLISPASTQQSIQLLYETCLCIWLLSYYEPAIEYLATSRTMQRLTEVVKHSTKEKVVRVVILTFRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKETNFWRENVTCFEENDFQILRVLLTILDTSSDPRSLAVACFDISQFIQYHAAGRVIVADLKAKERVMKLINHENAEVTKNAILCIQRLLLGAKYASFLQA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
1	Acetylation	-------MDQAELSI -------CCHHHHCH	8.54	22223895

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VATH_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VATH_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VATH_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of VATH_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VATH_ARATH

Related Literatures of Post-Translational Modification