UniProt ID | VATG1_ARATH | |
---|---|---|
UniProt AC | O82628 | |
Protein Name | V-type proton ATPase subunit G1 | |
Gene Name | VHA-G1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 110 | |
Subcellular Localization |
Cell membrane . Vacuole membrane Peripheral membrane protein . |
|
Protein Description | Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.. | |
Protein Sequence | MESNRGQGSIQQLLAAEVEAQHIVNAARTAKMARLKQAKEEAEKEIAEYKAQTEQDFQRKLEETSGDSGANVKRLEQETDTKIEQLKNEASRISKDVVEMLLKHVTTVKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MESNRGQG -------CCCCCCCC | - | ||
3 | Phosphorylation | -----MESNRGQGSI -----CCCCCCCCHH | 27545962 | ||
9 | Phosphorylation | ESNRGQGSIQQLLAA CCCCCCCHHHHHHHH | 30291188 | ||
65 | Phosphorylation | QRKLEETSGDSGANV HHHHHHHCCCCCCHH | 25561503 | ||
100 | Sulfoxidation | ISKDVVEMLLKHVTT HCHHHHHHHHHHHHH | 25693801 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VATG1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VATG1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VATG1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VATG1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...