| UniProt ID | VATG1_ARATH | |
|---|---|---|
| UniProt AC | O82628 | |
| Protein Name | V-type proton ATPase subunit G1 | |
| Gene Name | VHA-G1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 110 | |
| Subcellular Localization |
Cell membrane . Vacuole membrane Peripheral membrane protein . |
|
| Protein Description | Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.. | |
| Protein Sequence | MESNRGQGSIQQLLAAEVEAQHIVNAARTAKMARLKQAKEEAEKEIAEYKAQTEQDFQRKLEETSGDSGANVKRLEQETDTKIEQLKNEASRISKDVVEMLLKHVTTVKN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MESNRGQG -------CCCCCCCC | - | ||
| 3 | Phosphorylation | -----MESNRGQGSI -----CCCCCCCCHH | 27545962 | ||
| 9 | Phosphorylation | ESNRGQGSIQQLLAA CCCCCCCHHHHHHHH | 30291188 | ||
| 65 | Phosphorylation | QRKLEETSGDSGANV HHHHHHHCCCCCCHH | 25561503 | ||
| 100 | Sulfoxidation | ISKDVVEMLLKHVTT HCHHHHHHHHHHHHH | 25693801 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VATG1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VATG1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VATG1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of VATG1_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...