| UniProt ID | VATF_MOUSE | |
|---|---|---|
| UniProt AC | Q9D1K2 | |
| Protein Name | V-type proton ATPase subunit F | |
| Gene Name | Atp6v1f | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 119 | |
| Subcellular Localization | ||
| Protein Description | Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.. | |
| Protein Sequence | MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 30 | Ubiquitination | GGIGELNKNRHPNFL ECHHHHCCCCCCCEE | 68.90 | - | |
| 84 | Phosphorylation | ALDAHQRSIPAVLEI HHHHHHCCCCEEEEC | 26.76 | 22817900 | |
| 93 | Phosphorylation | PAVLEIPSKEHPYDA CEEEECCCCCCCCHH | 57.23 | 22817900 | |
| 94 | Ubiquitination | AVLEIPSKEHPYDAA EEEECCCCCCCCHHH | 55.47 | 22790023 | |
| 102 | Ubiquitination | EHPYDAAKDSILRRA CCCCHHHHHHHHHHH | 54.45 | 22790023 | |
| 104 | Phosphorylation | PYDAAKDSILRRAKG CCHHHHHHHHHHHCC | 23.86 | 29899451 | |
| 110 | Ubiquitination | DSILRRAKGMFTAED HHHHHHHCCCCCHHH | 49.44 | 22790023 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VATF_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VATF_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VATF_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of VATF_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...