UniProt ID | VATF_MOUSE | |
---|---|---|
UniProt AC | Q9D1K2 | |
Protein Name | V-type proton ATPase subunit F | |
Gene Name | Atp6v1f | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 119 | |
Subcellular Localization | ||
Protein Description | Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.. | |
Protein Sequence | MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Ubiquitination | GGIGELNKNRHPNFL ECHHHHCCCCCCCEE | 68.90 | - | |
84 | Phosphorylation | ALDAHQRSIPAVLEI HHHHHHCCCCEEEEC | 26.76 | 22817900 | |
93 | Phosphorylation | PAVLEIPSKEHPYDA CEEEECCCCCCCCHH | 57.23 | 22817900 | |
94 | Ubiquitination | AVLEIPSKEHPYDAA EEEECCCCCCCCHHH | 55.47 | 22790023 | |
102 | Ubiquitination | EHPYDAAKDSILRRA CCCCHHHHHHHHHHH | 54.45 | 22790023 | |
104 | Phosphorylation | PYDAAKDSILRRAKG CCHHHHHHHHHHHCC | 23.86 | 29899451 | |
110 | Ubiquitination | DSILRRAKGMFTAED HHHHHHHCCCCCHHH | 49.44 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VATF_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VATF_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VATF_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VATF_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...