VATE3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VATE3_ARATH
• UniProt AC: P0CAN7
• Protein Name: V-type proton ATPase subunit E3
• Gene Name: VHA-E3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 237
• Subcellular Localization: Vacuole membrane ; Peripheral membrane protein .
• Protein Description: Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity)..
• Protein Sequence: MNDADASIQIQQMVRFIRQEAEEKANEISISSEEEFNIEKLQLVEAEKKKIRQEYEKKEKQVDVRKKIDYSMQLNASRIKVLQAQDDIVNAMKEEAAKQLLKVSQHGFFNHHHHQYKHLLKDLIVQCLLRLKEPAVLLRCREEDLDIVESMLDDASEEYCKKAKVHAPEIIVDKDIFLPPAPSDDDPHALSCAGGVVLASRDGKIVCENTLDARLEVAFRNKLPEIRKSLFGKVGAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MNDADASI -------CCHHHHHH	10.39	-
71	Phosphorylation	VRKKIDYSMQLNASR HHHHHCHHHHCCHHH	9.05	22092075

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VATE3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VATE3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VATE3_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of VATE3_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.