UniProt ID | VATE1_RAT | |
---|---|---|
UniProt AC | Q6PCU2 | |
Protein Name | V-type proton ATPase subunit E 1 | |
Gene Name | Atp6v1e1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 226 | |
Subcellular Localization | ||
Protein Description | Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.. | |
Protein Sequence | MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDLEAYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MALSDADVQ ------CCCCHHHHH | 18.77 | - | |
4 | Phosphorylation | ----MALSDADVQKQ ----CCCCHHHHHHH | 22.63 | 23984901 | |
10 | Acetylation | LSDADVQKQIKHMMA CCHHHHHHHHHHHHH | 54.56 | 22902405 | |
52 | Acetylation | LVQTQRLKIMEYYEK CHHHHHHHHHHHHHH | 42.04 | 22902405 | |
56 | Phosphorylation | QRLKIMEYYEKKEKQ HHHHHHHHHHHHHHH | 10.27 | 30181290 | |
57 | Phosphorylation | RLKIMEYYEKKEKQI HHHHHHHHHHHHHHH | 14.15 | 30181290 | |
59 | Acetylation | KIMEYYEKKEKQIEQ HHHHHHHHHHHHHHH | 50.54 | 22902405 | |
60 | Acetylation | IMEYYEKKEKQIEQQ HHHHHHHHHHHHHHH | 59.20 | 22902405 | |
99 | Acetylation | TDLLNEAKQRLSKVV HHHHHHHHHHHHHHH | 29.76 | 22902405 | |
138 | Ubiquitination | RMIVRCRKQDFPLVK CEEEEECCCCCHHHH | 58.82 | - | |
145 | Acetylation | KQDFPLVKAAVQKAI CCCCHHHHHHHHHHC | 38.01 | 22902405 | |
150 | Acetylation | LVKAAVQKAIPMYKI HHHHHHHHHCCHHEE | 41.50 | 22902405 | |
156 | Acetylation | QKAIPMYKIATKKDV HHHCCHHEECCCCCC | 21.44 | 22902405 | |
191 | Acetylation | YNGDRKIKVSNTLES ECCCCEEEECCCHHH | 42.52 | 72592213 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VATE1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VATE1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VATE1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VATE1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...