dbPTM

VATE1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VATE1_ARATH
UniProt AC	Q39258
Protein Name	V-type proton ATPase subunit E1
Gene Name	VHA-E1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	230
Subcellular Localization	Vacuole membrane Peripheral membrane protein .
Protein Description	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Required for Golgi organization and vacuole function in embryogenesis..
Protein Sequence	MNDGDVSRQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQDYEKKEKQADVRKKIDYSMQLNASRIKVLQAQDDIVNAMKDQAAKDLLNVSRDEYAYKQLLKDLIVQCLLRLKEPSVLLRCREEDLGLVEAVLDDAKEEYAGKAKVHAPEVAVDTKIFLPPPPKSNDPHGLHCSGGVVLASRDGKIVCENTLDARLDVAFRMKLPVIRKSLFGQVTA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MNDGDVSR -------CCCHHHHH	10.47	22223895
71	Phosphorylation	VRKKIDYSMQLNASR HHHHCHHHHHCCHHH	9.05	22092075
92	Sulfoxidation	QDDIVNAMKDQAAKD HHHHHHHHHHHHHHH	4.08	23289948
178	Phosphorylation	FLPPPPKSNDPHGLH ECCCCCCCCCCCCCC	52.84	22092075
201	S-nitrosylation	SRDGKIVCENTLDAR CCCCEEEEECCHHHH	3.67	22115780

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VATE1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VATE1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VATE1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of VATE1_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VATE1_ARATH

Related Literatures of Post-Translational Modification