| UniProt ID | VATE1_ARATH | |
|---|---|---|
| UniProt AC | Q39258 | |
| Protein Name | V-type proton ATPase subunit E1 | |
| Gene Name | VHA-E1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 230 | |
| Subcellular Localization |
Vacuole membrane Peripheral membrane protein . |
|
| Protein Description | Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Required for Golgi organization and vacuole function in embryogenesis.. | |
| Protein Sequence | MNDGDVSRQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQDYEKKEKQADVRKKIDYSMQLNASRIKVLQAQDDIVNAMKDQAAKDLLNVSRDEYAYKQLLKDLIVQCLLRLKEPSVLLRCREEDLGLVEAVLDDAKEEYAGKAKVHAPEVAVDTKIFLPPPPKSNDPHGLHCSGGVVLASRDGKIVCENTLDARLDVAFRMKLPVIRKSLFGQVTA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MNDGDVSR -------CCCHHHHH | 10.47 | 22223895 | |
| 71 | Phosphorylation | VRKKIDYSMQLNASR HHHHCHHHHHCCHHH | 9.05 | 22092075 | |
| 92 | Sulfoxidation | QDDIVNAMKDQAAKD HHHHHHHHHHHHHHH | 4.08 | 23289948 | |
| 178 | Phosphorylation | FLPPPPKSNDPHGLH ECCCCCCCCCCCCCC | 52.84 | 22092075 | |
| 201 | S-nitrosylation | SRDGKIVCENTLDAR CCCCEEEEECCHHHH | 3.67 | 22115780 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VATE1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VATE1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VATE1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of VATE1_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...