VAP41_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VAP41_ARATH
• UniProt AC: Q1ECE0
• Protein Name: Vesicle-associated protein 4-1
• Gene Name: PVA41
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 266
• Protein Description: May play a role in vesicle trafficking..
• Protein Sequence: MPIGDRQNPSVEKKKNLFRLCPFWQRRSTTSSSSTQNPNQNYRSRHGNRNTDISAVSKPPLTMSSVARSLLPARRRLRLDPSSYLYFPYEPGKQVRSAIKLKNTSKSHTAFKFQTTAPKSCYMRPPGGVLAPGESVFATVFKFVEHPENNEKQPLNQKSKVKFKIMSLKVKPGVEYVPELFDEQKDQVAVEQVLRVIFIDADRPSAALEKLKRQLDEAEAAVEARKKPPPETGPRVVGEGLVIDEWKERREKYLARQQVESVDSLS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	Phosphorylation	NPNQNYRSRHGNRNT CCCCCCHHCCCCCCC	20.47	27545962
205	Phosphorylation	FIDADRPSAALEKLK EEECCCHHHHHHHHH	27.37	30291188
264	Phosphorylation	QQVESVDSLS----- HHHHHHHCCC-----	28.49	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VAP41_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VAP41_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VAP41_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of VAP41_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.