VAMP7_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VAMP7_RAT
• UniProt AC: Q9JHW5
• Protein Name: Vesicle-associated membrane protein 7
• Gene Name: Vamp7
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 220
• Subcellular Localization: Cytoplasmic vesicle, secretory vesicle membrane; Single-pass type IV membrane protein. Golgi apparatus, trans-Golgi network membrane; Single-pass type IV membrane protein. Late endosome membrane; Single-pass type IV membrane protein. Lysosome membrane; Si
• Protein Description: Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation..
• Protein Sequence: MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFGFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENQSLDRVTETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCVKNVKLTAIIVVVSIVFIYIIVSPLCGGFTWPSCVKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAILFAVVA ------CCHHHHHHC	13.75	-
118	Phosphorylation	AAQLKHHSENQSLDR HHHHHHCCCCCCCCH	37.65	25575281
122	Phosphorylation	KHHSENQSLDRVTET HHCCCCCCCCHHHHH	43.76	25575281
127	Phosphorylation	NQSLDRVTETQAQVD CCCCCHHHHHHHHHH	33.92	25575281
129	Phosphorylation	SLDRVTETQAQVDEL CCCHHHHHHHHHHHH	21.60	25575281
137	Ubiquitination	QAQVDELKGIMVRNI HHHHHHHHCEEEECC	44.32	-
167	Phosphorylation	KTENLVDSSVTFKTT CCCCCCCCCCCCCCC	21.16	27097102
168	Phosphorylation	TENLVDSSVTFKTTS CCCCCCCCCCCCCCC	22.25	28432305
170	Phosphorylation	NLVDSSVTFKTTSRN CCCCCCCCCCCCCHH	22.74	27097102
172	Ubiquitination	VDSSVTFKTTSRNLA CCCCCCCCCCCHHHH	41.34	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VAMP7_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VAMP7_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VAMP7_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of VAMP7_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.