| UniProt ID | VAMP5_HUMAN | |
|---|---|---|
| UniProt AC | O95183 | |
| Protein Name | Vesicle-associated membrane protein 5 | |
| Gene Name | VAMP5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 116 | |
| Subcellular Localization |
Cell membrane Single-pass type IV membrane protein . Endomembrane system Single-pass type IV membrane protein . Golgi apparatus, trans-Golgi network membrane Single-pass type IV membrane protein . Associated with the plasma membrane as well as |
|
| Protein Description | May participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.. | |
| Protein Sequence | MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | QQQANEVTEIMRNNF HHHHHHHHHHHHHCH | 17.39 | 29514088 | |
| 26 | Acetylation | IMRNNFGKVLERGVK HHHHCHHHHHHHHHH | 39.24 | 20167786 | |
| 26 | Ubiquitination | IMRNNFGKVLERGVK HHHHCHHHHHHHHHH | 39.24 | - | |
| 33 | Ubiquitination | KVLERGVKLAELQQR HHHHHHHHHHHHHHH | 44.82 | - | |
| 41 | Phosphorylation | LAELQQRSDQLLDMS HHHHHHHHHHHHHHH | 25.93 | 21082442 | |
| 47 | Sulfoxidation | RSDQLLDMSSTFNKT HHHHHHHHHHHHCHH | 3.26 | 21406390 | |
| 48 | Phosphorylation | SDQLLDMSSTFNKTT HHHHHHHHHHHCHHH | 26.37 | 28355574 | |
| 49 | Phosphorylation | DQLLDMSSTFNKTTQ HHHHHHHHHHCHHHH | 30.31 | 21082442 | |
| 50 | Phosphorylation | QLLDMSSTFNKTTQN HHHHHHHHHCHHHHH | 24.74 | 23911959 | |
| 53 | Ubiquitination | DMSSTFNKTTQNLAQ HHHHHHCHHHHHHHH | 49.08 | - | |
| 54 | Phosphorylation | MSSTFNKTTQNLAQK HHHHHCHHHHHHHHH | 34.42 | 26270265 | |
| 55 | Phosphorylation | SSTFNKTTQNLAQKK HHHHCHHHHHHHHHH | 19.64 | 26270265 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VAMP5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VAMP5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VAMP5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of VAMP5_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-41; SER-48 AND SER-49,AND MASS SPECTROMETRY. | |
