UniProt ID | VAMP3_RAT | |
---|---|---|
UniProt AC | P63025 | |
Protein Name | Vesicle-associated membrane protein 3 | |
Gene Name | Vamp3 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 103 | |
Subcellular Localization |
Membrane Single-pass type IV membrane protein . Cell junction, synapse, synaptosome. |
|
Protein Description | SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.. | |
Protein Sequence | MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGISVLVIIVIIIIVWCVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSTGVPSGS ------CCCCCCCCC | 33.59 | - | |
2 | Phosphorylation | ------MSTGVPSGS ------CCCCCCCCC | 33.59 | 23984901 | |
3 | Phosphorylation | -----MSTGVPSGSS -----CCCCCCCCCC | 40.68 | 23984901 | |
7 | Phosphorylation | -MSTGVPSGSSAATG -CCCCCCCCCCCCCC | 49.23 | 23984901 | |
9 | Phosphorylation | STGVPSGSSAATGSN CCCCCCCCCCCCCCH | 22.57 | 23984901 | |
10 | Phosphorylation | TGVPSGSSAATGSNR CCCCCCCCCCCCCHH | 26.00 | 23984901 | |
13 | Phosphorylation | PSGSSAATGSNRRLQ CCCCCCCCCCHHHHH | 40.64 | 27097102 | |
15 | Phosphorylation | GSSAATGSNRRLQQT CCCCCCCCHHHHHHH | 23.86 | 27097102 | |
39 | Acetylation | IMRVNVDKVLERDQK HHCCCHHHHHHHHHH | 44.42 | 22902405 | |
39 | Ubiquitination | IMRVNVDKVLERDQK HHCCCHHHHHHHHHH | 44.42 | - | |
46 | Acetylation | KVLERDQKLSELDDR HHHHHHHHHHHHHHH | 59.26 | 22902405 | |
46 | Ubiquitination | KVLERDQKLSELDDR HHHHHHHHHHHHHHH | 59.26 | - | |
48 | Phosphorylation | LERDQKLSELDDRAD HHHHHHHHHHHHHHH | 43.05 | 25403869 | |
62 | Phosphorylation | DALQAGASQFETSAA HHHHHHHHHHHHHHH | 34.19 | 30240740 | |
66 | Phosphorylation | AGASQFETSAAKLKR HHHHHHHHHHHHHHH | 25.59 | 27097102 | |
67 | Phosphorylation | GASQFETSAAKLKRK HHHHHHHHHHHHHHH | 21.02 | 27097102 | |
70 | Ubiquitination | QFETSAAKLKRKYWW HHHHHHHHHHHHHHH | 55.01 | - | |
72 | Ubiquitination | ETSAAKLKRKYWWKN HHHHHHHHHHHHHHH | 46.25 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VAMP3_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VAMP3_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VAMP3_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VAMP3_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...