VA726_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VA726_ARATH
• UniProt AC: Q9MAS5
• Protein Name: Putative vesicle-associated membrane protein 726
• Gene Name: VAMP726
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 220
• Subcellular Localization: Cell membrane ; Single-pass type IV membrane protein . Early endosome membrane ; Single-pass type IV membrane protein .
• Protein Description: Involved in the targeting and/or fusion of transport vesicles to their target membrane..
• Protein Sequence: MGQQSLIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLADNGFTYCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQYCADHPEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKRKLWFENMKIKLIVFGIIVALILIIILSVCHGFKCT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
166	Phosphorylation	IELLVDKTENLRSQA EEEEEECCHHHHHHH	26.16	30291188
171	Phosphorylation	DKTENLRSQAQDFRT ECCHHHHHHHHHHHH	32.79	27288362

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VA726_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VA726_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VA726_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MLO4_ARATH	MLO4	physical	22737156
CDPK1_ARATH	CPK1	physical	22737156
CAAT6_ARATH	CAT6	physical	22737156

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.