VA724_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VA724_ARATH
• UniProt AC: O23429
• Protein Name: Vesicle-associated membrane protein 724 {ECO:0000303|PubMed:11115874}
• Gene Name: VAMP724 {ECO:0000303|PubMed:11115874}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 222
• Subcellular Localization: Cell membrane ; Single-pass type IV membrane protein . Early endosome membrane ; Single-pass type IV membrane protein .
• Protein Description: Involved in the targeting and/or fusion of transport vesicles to their target membrane..
• Protein Sequence: MGQESFIYSFVARGTMILAEYTEFTGNFPSIAAQCLQKLPSSSNSKFTYNCDHHTFNFLVEDGYAYCVVAKDSLSKQISIAFLERVKADFKKRYGGGKASTAIAKSLNKEFGPVMKEHMNYIVDHAEEIEKLIKVKAQVSEVKSIMLENIDKAIDRGENLTVLTDKTENLRSQAQEYKKQGTQVRRKLWYQNMKIKLVVLGILLLLVLIIWISVCHGFNCTD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
140	Phosphorylation	IKVKAQVSEVKSIML HHHHHHHHHHHHHHH	25.29	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VA724_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VA724_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VA724_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of VA724_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.