VA713_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VA713_ARATH
• UniProt AC: Q9LFP1
• Protein Name: Vesicle-associated membrane protein 713 {ECO:0000303|PubMed:11115874}
• Gene Name: VAMP713 {ECO:0000303|PubMed:11115874}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 221
• Subcellular Localization: Vacuole membrane ; Single-pass type IV membrane protein . Prevacuolar compartment membrane ; Single-pass type IV membrane protein . Strong colocalization with VAMP713 at the contact sites of two vacuoles.
• Protein Description: Involved in the targeting and/or fusion of transport vesicles to their target membrane..
• Protein Sequence: MAIIFALVARGTVVLSEFSATSTNASSISKQILEKLPGNDSDSHMSYSQDRYIFHVKRTDGLTVLCMADETAGRNIPFAFLDDIHQRFVKTYGRAIHSAQAYSMNDEFSRVLSQQMEFYSNDPNADRMSRIKGEMSQVRNVMIENIDKVLDRGERLELLVDKTENMQGNTFRFRKQARRYRTIMWWRNVKLTIALILVLALVVYIAMAFVCHGPSLPSCFK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAIIFALVA ------CHHHHHHHH	12.00	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VA713_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VA713_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VA713_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of VA713_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.