| UniProt ID | V1BR_HUMAN | |
|---|---|---|
| UniProt AC | P47901 | |
| Protein Name | Vasopressin V1b receptor | |
| Gene Name | AVPR1B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 424 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
| Protein Description | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.. | |
| Protein Sequence | MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | N-linked_Glycosylation | RGTLSAPNATTPWLG CCCCCCCCCCCCCCC | 50.03 | UniProtKB CARBOHYD | |
| 231 | Ubiquitination | HEICKNLKVKTQAWR HHHHHCCCCCCCEEE | 51.59 | 32015554 | |
| 251 | Phosphorylation | WRTWDRPSPSTLAAT CCCCCCCCHHHHHHH | 32.17 | 28857561 | |
| 258 | Phosphorylation | SPSTLAATTRGLPSR CHHHHHHHCCCCCCC | 16.06 | 28857561 | |
| 267 | Phosphorylation | RGLPSRVSSINTISR CCCCCCHHCCCHHCC | 25.13 | - | |
| 268 | Phosphorylation | GLPSRVSSINTISRA CCCCCHHCCCHHCCH | 19.59 | 28857561 | |
| 271 | Phosphorylation | SRVSSINTISRAKIR CCHHCCCHHCCHHHH | 20.75 | - | |
| 338 | Phosphorylation | SCCNPWIYMGFNSHL HHCCHHHHCCCCHHC | 6.31 | 12436935 | |
| 368 | Phosphorylation | PRMRRRLSDGSLSSR HHHHHHCCCCCCCCC | 37.81 | 26657352 | |
| 371 | Phosphorylation | RRRLSDGSLSSRHTT HHHCCCCCCCCCCEE | 30.03 | 29691806 | |
| 374 | Phosphorylation | LSDGSLSSRHTTLLT CCCCCCCCCCEEEEC | 33.12 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of V1BR_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of V1BR_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of V1BR_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of V1BR_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| D00101 | Vasopressin (JP16/USP); Pitressin (TN) | |||||
| D00291 | Desmopressin (INN) | |||||
| D00366 | Lypressin (USP/INN); Diapid (TN) | |||||
| D02235 | Desmopressin acetate hydrate (JAN); Desmopressin acetate (USAN); Desmopressin acetate trihydrate; DD | |||||
| D02983 | Argipressin tannate (USAN); Pitressin tannate (TN) | |||||
| D06672 | Terlipressin (USAN/INN); Lucassin (TN) | |||||
| D07227 | Ornipressin (INN); POR 8 Sandoz (TN) | |||||
| D08571 | Terlipressin acetate (JAN); Heamopressin (TN) | |||||
| D09820 | Vasopressin tannate (JAN) | |||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
