UniProt ID | UXS6_ARATH | |
---|---|---|
UniProt AC | Q9ZV36 | |
Protein Name | UDP-glucuronic acid decarboxylase 6 | |
Gene Name | UXS6 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 343 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose. Necessary for the biosynthesis of the core tetrasaccharide in glycosaminoglycan biosynthesis (By similarity).. | |
Protein Sequence | MASNSSNGTTTTKPPPMPSPLRNSKFFQSNMRILVTGGAGFIGSHLVDKLMQNEKNEVIVADNYFTGSKDNLKKWIGHPRFELIRHDVTEPLFVEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQTESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRGEALTVQKPGTQTRSFCYVSDMVEGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELIKPDVEIKMVENTPDDPRQRKPDISKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVPKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASNSSNGT ------CCCCCCCCC | - | ||
209 | Sulfoxidation | FNTYGPRMNIDDGRV HHCCCCCCCCCCCCH | 23289948 | ||
293 | Sulfoxidation | KPDVEIKMVENTPDD CCCCEEEEEECCCCC | 23289948 | ||
330 | Sulfoxidation | LREGLPLMEEDFRLR CCCCCCCCCCCCHHH | 23289948 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UXS6_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UXS6_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UXS6_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of UXS6_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...