dbPTM

UTP18_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UTP18_CAEEL
UniProt AC	P42000
Protein Name	U3 small nucleolar RNA-associated protein 18 homolog
Gene Name	B0280.9
Organism	Caenorhabditis elegans.
Sequence Length	429
Subcellular Localization	Nucleus, nucleolus.
Protein Description	Involved in nucleolar processing of pre-18S ribosomal RNA..
Protein Sequence	MSKRPVIESEKPAWHDEDDDNMVVAVPKKVKMTMRVELKRTTDEEHGELDSKEYVGRLQEAFRKRHGGTPKWAKAAAGDEEEGSLLKTAAGYLAKDVNLPKTTIHTTLIKDFNIGHRYTRGITVVKFHKTRPVLIVADQGGNVQLFKVSREVKKDRFLQSANFSKFPIDSLEIADKGHSVICSSSRKEYLMQYNMETREVTQLKPPNTVPKQGIRLFAISHDSQFLAIAGHNSHIYVLHATSMEHITTISLPANASEIKFFPSHSREIWIICETGQIVIANIGLPGTKSSQHTFTDDGAVHGTTLAISQHGDYFATGSDTGIVNVYSGNDCRNSTNPRPLFNVSNLVTAVSSIAFNSDAQLMAICSNVKDNHLRLVHVASQTTFKNFPERNGKVTHARCVEFSPNGGYMAVGNDDGRLHVFEIHHFTDY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
42	Phosphorylation	RVELKRTTDEEHGEL EEEEEECCCCCCCCC	45.50	26392051

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UTP18_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UTP18_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UTP18_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of UTP18_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UTP18_CAEEL

Related Literatures of Post-Translational Modification